CAZyme Information: AWU75497.1

Basic Information

• Species: Pichia kudriavzevii
• Lineage: Ascomycota; Saccharomycetes; ; Pichiaceae; Pichia; Pichia kudriavzevii
• CAZyme ID: AWU75497.1
• CAZy Family: GH72
• CAZyme Description: Initiation-specific alpha-1,6-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A099P1Q4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		47318.17	5.3444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PkudriavzeviiCBS573	5367	N/A	212	5155

• Gene Location: location=CP028774:1577960-1579174(+)

Full Sequence      

MAASSNRARVVSILLGLALGYSLFLLNSLSSNQTSRAITNFYRFNPHTRGANPYEYKTTL
DRLALHFPYDQSPRRIDKNIFQMWKVPATDPDFPHRDLIMQWKNENPTYKYNLYTDAEIH
DILVQHFANTVPEVVEAFDLMPNKIIQSDFSRYLLIFLFGGVYSDIDTKLEKPIDTWFDS
DRNVGFVVAIEEDMNVENWEHYMTRRVQFEQWTFKAKARHPILRKLISKIVETTFRAARD
DKLQAYYKDFQGVDKCSSVDIMEWTGPVVWTDTIYGHLNSIENPTIVDIDANRYVQGELY
GPEEEAKKLISWRFFTGLEAPVMIDDVVIYPKLSFREDRANNCGKYCYVFHEFGGSWKNN
GKGEEKPQEDEQQQQESHEDNNEEHAERRKVKRDEGCSYPYSPL

Enzyme Prediction     

No EC number prediction in AWU75497.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	98	179	5.6e-19	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.60e-21	56	273	63	282	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.42e-14	95	182	4	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU75497.1|GT32	1.76e-295	1	404	1	404
AAQ06408.1|GT32|2.4.1.257	1.81e-196	4	367	16	384
ABB83803.1|GT32	4.50e-76	46	359	51	361
QFZ43557.1|GT32	1.05e-67	45	364	62	375
QFZ32205.1|GT32	1.05e-67	45	364	62	375

PDB Hits     

AWU75497.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.55e-65	44	364	69	382	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.55e-51	58	366	113	396	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.40e-48	61	360	82	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.40e-37	102	360	165	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q10323|IMT3_SCHPO	1.39e-06	56	175	34	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995879	0.004154

TMHMM  Annotations     

Start	End
7	29