CAZyme Information: AWU75364.1

Basic Information

• Species: Pichia kudriavzevii
• Lineage: Ascomycota; Saccharomycetes; ; Pichiaceae; Pichia; Pichia kudriavzevii
• CAZyme ID: AWU75364.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	CP028774|CGC17	68280.80	4.8280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PkudriavzeviiCBS573	5367	N/A	212	5155

• Gene Location: location=CP028774:1256633-1258378(-)

Full Sequence      

MALSRRIQRTLILLVSIFALTCVLNFFKHKNSIVYLKNPTIPKSKIGEIVDSTPFDISTI
RTIKQESILQNYRSFTIEHPEIINWDKFAYVFYATSPDQLLPVFINVKELRKLETQAQIH
LIYSFHGVGDDSRTERMLKLLETRYSTKLEKIEPIRPTADDFSSWSDSFTKLYAFKLVQY
DRIVYLDADSVIRKHMDELFLLPPALIAAPLNYIDYRKIYKPTIWDDLGILDKLDDIPPT
PFEYELITQDLYHSIIENELEFNDHYFWSLYAALQTLDNTIELSPHMKLASYLMVITPDL
NVFEWISKVISKRKQEEYDMEIINNVFNINEVRDNNFHIRQRNGDIGNSNPWLQGEIIPA
VLILPHNTYSLLSGEFRHPVFQHSAYLVSPADIGYLEKESPSLSFQRALKGIHYKDIEEV
VEIFPEVPYWDWGWRFDIDGKCTDIEELGINEKVGGNGEEDEKIDLGLNIQNLGWDSKKI
LENSHYIHWSDWPLDKPWRFTDDSEKELEKMFEVGLNKCRENARSVFLEIDLNENVREKI
KGRLDNELNFALRNCDESLNVWKKIYQYYGDLVNFAIEEIK

Enzyme Prediction     

No EC number prediction in AWU75364.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	82	500	5.1e-16	0.9027237354085603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	3.24e-36	88	416	1	231	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	2.01e-20	88	242	1	157	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.10e-11	87	222	70	211	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	6.27e-06	89	217	2	135	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
215090	PLN00176	0.005	152	204	81	137	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU75364.1|GT8	0.0	1	581	1	581
QPG75956.1|GT8	1.25e-65	25	572	44	524
QOU18967.1|GT8	3.48e-59	35	573	78	553
CAR28822.1|GT8	2.01e-29	60	447	61	460
CAR23651.1|GT8	6.43e-29	12	416	19	433

PDB Hits     

AWU75364.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FQ15|GNT1_CANGA	3.30e-29	60	569	61	480	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q6CT96|GNT1B_KLULA	8.74e-26	5	416	3	405	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q12096|GNT1_YEAST	5.50e-25	26	509	45	454	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q59ZI3|GNT1_CANAL	4.76e-23	84	416	67	393	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	1.03e-22	83	416	150	385	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986014	0.014007

TMHMM  Annotations     

Start	End
7	27