CAZyme Information: ATY67453.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY67453.1
• CAZy Family: PL35
• CAZyme Description: peroxidase catalase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		91298.79	7.0426

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023328:1550388-1553227(-)

Full Sequence      

MALPGRFSAGGGPAIPNRRLAPSAVLPRSINSAKLPPSFLLLPPSSLLTSLYFFPKSHPS
RRPPPLPPPMSSDFKIPLSHKRDISTDDQSPRKKMAQQSTGKCPVVHTADTGRKNPDWWP
NAVKLNILRQHNPSSNPLGPDFDYAAAFKSLDYNALKKDLHALMTDSQDWWPADFGHYGG
FFIRMSWHAAGTYRVFDGRGGGGEGQQRFAPLNSWPDNGNLDKARRLLWPIKQKYGNKIS
WADLLVLAGNVALESMGFKTFGFAGGRADTWESDEAVYWGSEPEWMTDSHRYSKDSSGKR
DPESLEKPLGAQIMGLIYVNPGVEDPVAAAHDIRTTFGRMAMNDEETVALIAGGHTFGKT
HGAAPDSNVGAEPAGADIEQQGFGWKNGYNTGKGTHAITSGLEVTWTSTPTKWSNQFFEY
LFKFEWELTKSPAGAPQWVAKNTEPFIPDAFDPSKKHLPKMLTTDLSLRVDPAYEKISRR
FLENPDQFADAFARAWFKLLHRDLGPKALYLGPEIPSEDLLWQDPIPTLNHAVIDSNDVA
ALKKAILDTGLSTSKLVSTAWASAATFRGSDKRGGANGARIRLAPMKDWEVNNPAQLSEV
LGQLETIQKKFNDSQSGGKRVSIADLIVLAGAAGVEQAAKGAGVDVTVPFTPGRMDATAE
QTDIESNNYLEPITDGFRNYAGNGSIERLEHWLVDRAHLLTLTPPELAVLVGGLRTINTN
YDGSSHGVLTSRPGTLSNDFFTNLLDMNTVWEPIQPQSGVYKGSDRKSGEQKWTATRVDL
IFGSHAELRALGEVYAQADNSQKFVKDFVAAWDKVMNLDRFDVDVASKPRL

Enzyme Prediction     

No EC number prediction in ATY67453.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237891	PRK15061	0.0	98	823	1	725	catalase/peroxidase.
173828	catalase_peroxidase_2	0.0	524	820	1	297	C-terminal non-catalytic domain of catalase-peroxidases. This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong to plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear.
223453	KatG	0.0	78	823	2	729	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
173824	catalase_peroxidase_1	0.0	110	520	1	409	N-terminal catalytic domain of catalase-peroxidases. This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms, where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong to class I of the plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear.
272957	cat_per_HPI	0.0	102	823	3	713	catalase/peroxidase HPI. As catalase, this enzyme catalyzes the dismutation of two molecules of hydrogen peroxide to dioxygen and two molecules of water. As a peroxidase, it uses hydrogen peroxide to oxidize donor compounds and produce water. KatG from E. coli is a homotetramer with two non-covalently associated iron protoheme IX groups per tetramer, but the ortholog from Synechococcus sp. is a homodimer with one protoheme. Important sites (numbered according to E. coli KatG) include heme ligands His-106 and His-267 and active site Trp-318. Note that the translation PID:g296476 from accession X71420 from Rhodobacter capsulatus B10 contains extensive frameshift differences from the rest of the orthologous family. [Cellular processes, Detoxification]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ91289.1|AA0	0.0	102	830	6	757
UPK95725.1|AA0	0.0	90	831	54	817
UPM44564.1|AA0	5.61e-300	113	824	3	715
UKZ83034.1|AA0	7.22e-293	101	829	56	792
UKZ91589.1|AA0	8.79e-287	101	823	56	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5SXX_A	0.0	102	823	6	727	Crystal structure of the E198A variant of Burkholderia pseudomallei catalase-peroxidase KatG with INH [Burkholderia pseudomallei 1710b],5SXX_B Crystal structure of the E198A variant of Burkholderia pseudomallei catalase-peroxidase KatG with INH [Burkholderia pseudomallei 1710b]
5SYW_A	0.0	102	823	6	727	Crystal structure of Burkhoderia pseudomallei KatG variant Q233E [Burkholderia pseudomallei 1710b],5SYW_B Crystal structure of Burkhoderia pseudomallei KatG variant Q233E [Burkholderia pseudomallei 1710b]
5SYV_A	0.0	102	823	6	727	Crystal structure of Burkholderia pseudomallei KatG N240D variant [Burkholderia pseudomallei 1710b],5SYV_B Crystal structure of Burkholderia pseudomallei KatG N240D variant [Burkholderia pseudomallei 1710b]
5SYU_A	0.0	102	823	6	727	Crystal structure of Burkholderia pseudomallei KatG E242Q variant [Burkholderia pseudomallei 1710b],5SYU_B Crystal structure of Burkholderia pseudomallei KatG E242Q variant [Burkholderia pseudomallei 1710b]
5SYY_A	0.0	102	823	6	727	Crystal structure of the S324G variant of catalase-peroxidase from B. pseudomallei [Burkholderia pseudomallei 1710b],5SYY_B Crystal structure of the S324G variant of catalase-peroxidase from B. pseudomallei [Burkholderia pseudomallei 1710b]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0BI48|KATG1_BURCM	0.0	102	823	6	727	Catalase-peroxidase 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=katG1 PE=3 SV=1
sp|Q2H7U1|KATG_CHAGB	0.0	101	823	2	739	Catalase-peroxidase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=katG PE=3 SV=1
sp|Q1BYZ9|KATG1_BURCA	0.0	102	823	6	727	Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain AU 1054) OX=331271 GN=katG1 PE=3 SV=1
sp|Q0CD12|KATG_ASPTN	0.0	102	829	5	734	Catalase-peroxidase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=katG PE=3 SV=1
sp|Q2TW34|KATG_ASPOR	0.0	102	824	10	751	Catalase-peroxidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=katG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ATY67453.1.