CAZyme Information: ATY67327.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY67327.1
• CAZy Family: GT41
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	CP023328|CGC1	44672.55	8.5254

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023328:1362234-1363424(+)

Full Sequence      

MAWLSRMLGGSRQTKYEAVPDEEAGDASPSRPYRRRSRTRLLLPRQRKAAAVLLCIDVLI
VVTLVIVLEPLITLLRRNEDLFTPRLELHNVAAAPDVPGAKHKIPRILHQTTPNDTIPAK
WVESQRSCKEVYKDYEYMVSRLTPNLGARLVAACTLGTSSLTSTQLWTDKGAEEFLATNY
SDFVESWKNYAFPIQRADAIRYFVLYHFGGIYLDMDTQCNQTFPMQEVENDSSNDVAIFK
STAPTGVTNDLMIASARHPAFTMAIAQLPYYYAWTRFWAEYGPYINIMLSSGPLFISLVV
KDYLLTLPTTPSPTVKVISPPGLDGYITDLESSTWHRADAQTLMWLGTRPWTWFTLGAVG
TFFGLCLINYLLLALYGFFARRVLSLSARLKEAKVA

Enzyme Prediction     

No EC number prediction in ATY67327.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	121	224	7.4e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.31e-41	103	373	81	314	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.12e-14	118	225	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY67327.1|GT32	2.37e-289	1	396	1	396
UKZ78464.1|GT32	1.21e-130	21	396	9	370
QYS99794.1|GT32	2.98e-129	21	396	10	372
UKZ69326.1|GT32	7.49e-129	21	396	4	358
UKZ96119.1|GT32	1.78e-128	21	396	9	363

PDB Hits     

ATY67327.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.04e-38	47	343	2	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	4.88e-38	104	341	62	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.37e-34	77	345	61	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.37e-34	104	363	57	281	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.73e-32	86	346	46	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999958	0.000059

TMHMM  Annotations     

Start	End
50	72
351	373