CAZyme Information: ATY67306.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY67306.1
• CAZy Family: GT69
• CAZyme Description: GPI-anchored cell wall beta-1,3-endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	CP023328|CGC6	43053.44	4.7014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023328:1452835-1454079(+)

Full Sequence      

MHLTSTLLAGAAAVASAAAADNYLGFNSGSTLADRSAKFKKDFEAEFKTAQALNGAPGKF
NAVRLYTNIQAYATDDPIEAFEAAIDTQTYLLLGIWTSGTDNISKELSALQKAVTKYGSK
FTDLVIGMSIGSEDLYRNSVTGTKNKAGVGADPEVIVSFIKDYKKAFDGGALAKVPIGHV
DTWDSWTNSSNKAVIDAVDWVGVDEYPYYENDKGNNIKNAGKLFDKAYLATKAAVGDKPV
WVTETGWPVTGEKWDEAEPSAENAKYYWDEVGCRQLFGKTPTFWYNLRDSNPDNTMKFAI
TKDLSTTPLFNLTCPTTFDTDSSDSSSSASSGSSTATSRSDGSSTSLSSPTSSGSSGSGP
SSGSAAATSSAGSSSAGASGSAKATAASGSGAGKMLASSTVAGVLALAGAFFLL

Enzyme Prediction     

No EC number prediction in ATY67306.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.54e-23	24	273	46	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.15e-07	93	291	69	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY67306.1|GH17	2.18e-246	1	414	1	414
UNI15929.1|GH17	7.00e-181	1	320	1	319
QPG98530.1|GH17	2.48e-179	1	322	1	321
UQC77015.1|GH17	2.85e-179	5	323	4	322
CAQ16224.1|GH17	6.67e-175	5	316	4	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.09e-14	60	274	59	253	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	6.72e-101	23	314	20	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q0C7P6|EGLC_ASPTN	2.87e-97	1	323	1	320	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	9.24e-96	1	314	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	2.50e-94	7	314	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	2.81e-94	7	314	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.030586	0.969388	CS pos: 19-20. Pr: 0.7371

TMHMM  Annotations     

There is no transmembrane helices in ATY67306.1.