CAZyme Information: ATY66624.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY66624.1
• CAZy Family: GT31
• CAZyme Description: Glycosyl family 25

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	CP023327|CGC12	45565.59	6.3663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023327:266557-267933(+)

Full Sequence      

MEKTSHWLDVPSSLLGGGRARLLRVAGLLCICLVLTLLYSTSGGGGRHMLYNTRPAGSKT
TVALARPSRAEQRLMDAAGNATLGFASVQFINLPLRFDRLDAATLQAWLSGVDITEVKGV
GAAEIIDVGMPPEHLTRVKKTEKGCWRAHANIWSQMLRDKTPAVLVLESDAAWDVEVRAI
MRTLNQHFTYLLDALHSRSLPNPSFRARDGSAGGGGARVTLDPDDPWHSTHWDLLSLGQC
FEDPKHKDDAVRYPDAHVAPGSDYWGDALGAERVVRRSGGIVCTTAYAVSQTGAAKLLLR
SAVDLDNPVDLVMRRMILSGDLRVYSVMPTVFGQWEYVDGIGMSERGANSDIHGGGNPDA
PAEPLNLTGWDTVQQTGSIWQNREGHPSIAFTDMALQKAWGLIMGDSTLPASQFNETDGN

Enzyme Prediction     

No EC number prediction in ATY66624.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	87	313	2e-20	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.23e-12	91	176	5	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	3.75e-05	142	329	68	204	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY66624.1|GT25	3.95e-316	1	420	1	420
QLI71971.1|GT25	2.04e-148	71	420	58	403
QLI64049.1|GT25	2.64e-111	23	405	30	415
QLI72726.1|GT25	1.05e-101	78	405	62	387
QBZ65590.1|GT25	2.45e-80	9	406	4	385

PDB Hits     

ATY66624.1 has no PDB hit.

Swiss-Prot Hits     

ATY66624.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000007

TMHMM  Annotations     

Start	End
21	43