CAZyme Information: ATY66192.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY66192.1
• CAZy Family: GT2
• CAZyme Description: class 2 chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1173	CP023326|CGC4	131068.21	8.5270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023326:1779844-1783477(+)

Full Sequence      

MDRPNTPSRPPDYSFHTYDDDHDTPNGTSSAAVRLLTSVESPIDEPMPYVSKNYSTQLPF
PVSRCPSQASQFWPATRQKSITVPPNALLRQAQDSHFPTLATQSRPQAHLSTHTPSLTKS
PIRPKAAKLHKKPSVNPSHAQKPVSVASEELPQVLPTLPAGPSERFQLRRTDSVATLPPK
TSGIKGSPFLRSSPKLQRADGNTTLQPATSPSCENTPITFSDTSARKPYQPYQPSVTSPS
RASSIKDDTRAMPPPDSTYVPFAGRDGGSPQRPWTPSSRVSEFSRPPPTNLSFEPSELNG
NPRPGTPSSRYGGSPRRPLPPAPLFSNPSRDSQAFADDATVNIPLDDDGDDVFGPSSDLS
DSRPLPSTRDSFQSESQDTLNDKDEEYYEKVERYGPAPDGAQERRGVRAPQMSRKEVQLI
NGELVLECKIPTILYSFLPRRDEVEFTHMRYTAVTCDPDDFVERGYKLRQSIGRTTRETE
LFICITMYNEDEICFTRTMHAVMKNISHFCSRSRSRTWGETGWHKIVVCVICDGRPKIHP
RTLDALAAMGVFQHGIAKNFVNNRAVQAHVYEYTTQVSLDADLKFKGAEKGIVPCQMIFC
LKEKNRGKLNSHRWFFNAFGRALNPNICILLDVGTRPGGNSLYHLWKAFDTDSNVAGACG
EIKAMKGKYGSSLLNPLVASQNFEYKMSNILDKPLESVFGYITVLPGALSAYRYHALQND
EHGHGPLSQYFKGETLHGQHADVFTANMYLAEDRILCWELVAKRGERWVLKYVKGCTGET
DVPDSVPEFISQRRRWLNGAFFAAVYSLVNFRQIIHTDHTIARKVLLYMEFVYQACQLLF
TYFSLANFYLTFYFVAGGLTEKEVDPFGHNIGTVIFIILRYTCVLLIATQFILSLGNRPQ
GAKKMYLASMIIYAVIMAYTTFAVIYIVIRQLTDKTNLHKFNIGNNVFTNLIVSLTSTVG
LYILMSLVYLDPWHMMTSSLQYFMLLPSYICTLQVYAFCNTHDITWGTKGDNVIKTDLGG
AVGKGQTVELEMPSEQLDIDSGYDEALRNLRDRVAVAKPSISDSQLQEDYYKSVRTYMVV
TWMVANGILAMAVSEIYSNKGIGDNFYLRFILWSVAALAVFRALGSTTFAIINLVNTVVE
GRIRMSLKAPKWMGGLGDKMSEAASSVGSSLKR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	487	649	4.6e-76	0.9938650306748467
GT2	627	867	4e-22	0.43263757115749524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.49e-109	487	649	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.33e-96	483	803	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	2.47e-33	416	486	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.90e-30	598	939	115	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.44e-18	485	723	3	170	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY66192.1|GT2	0.0	1	1173	1	1173
AAU93842.1|GT2	0.0	219	1173	7	971
QLI70985.1|GT2	0.0	220	1172	43	992
UNI20420.1|GT2	0.0	1	1172	1	997
QUC15948.1|GT2	0.0	232	1162	55	982

PDB Hits     

ATY66192.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30600|CHS1_EXODE	0.0	430	1169	211	954	Chitin synthase 1 OS=Exophiala dermatitidis OX=5970 GN=CHS1 PE=3 SV=2
sp|P30589|CHS2_NEUCR	0.0	243	1153	120	1071	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4
sp|P30584|CHSA_EMENI	0.0	240	1171	38	975	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|Q92444|CHS2_PARBR	0.0	269	1146	82	976	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2
sp|P87073|CHS1_PHYB8	1.53e-287	393	1134	88	838	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

Start	End
837	859
871	893
906	928
948	970
980	999
1076	1098
1113	1135