CAZyme Information: ATY66100.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY66100.1
• CAZy Family: PL20
• CAZyme Description: Chondroitin N-acetylgalactosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	CP023326|CGC14	61655.04	6.5360

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023326:1260889-1262640(+)

Full Sequence      

YTLKQPPTLSSNQLALLPTPPHQSRSSCMHAPSPTMLPLVRSLASTPCWPQHKQFRRTLI
IAVVALACLALLQARWHDIALLRGNKPAAKLAGYPVAVIENDDAPRTMVTASAFRPVAYP
AGHNKTLAELCASFPRHLLATVQPVLKTGFTDAPGRLLSQMESCSACFAPGDLLVFSDLD
DVYRGHEVIDLLATLPAAYHAYEQFAPYFEQKRLRDSGEAAANPDALGAINGWKLDKFKF
LPQVEKAWEMKPNRDFYVFYETDTYVFWDPLLRFLDTLDPDTPLYLGSASPGRQDELGRD
TWFANGGPGYVLSRAAVQKLLHRRVSPAGVYIDPPFAEKHRHLLHDLECCGDSALGYALW
QSGIQLQALYPMFSQHPLHHTPFDAMRWCSPLLTMHKSSFDDMRAVFQWEFTARSNDYAM
RHRDLWEFNKPGSESRRADWRNDDRFGRKVEGDVVIDTQEACEAHCRSLEACLMWMWHGD
DVDECVVSEDVLLYGQEARPESVDDRRQASYTSGWIVDRVKEWKARHECNDTLWLSHSFA
RIF

Enzyme Prediction     

No EC number prediction in ATY66100.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	4.32e-06	263	320	94	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
250845	Galactosyl_T	0.008	247	324	74	171	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY66100.1|GT31	0.0	1	543	1	543
ATY64941.1|GT31	3.24e-182	53	543	24	493
QLI66050.1|GT31	6.18e-148	99	543	57	504
UKZ86901.1|GT31	8.29e-141	110	543	73	507
ANH56604.1|GT31	3.01e-140	110	541	70	502

PDB Hits     

ATY66100.1 has no PDB hit.

Swiss-Prot Hits     

ATY66100.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999918	0.000097

TMHMM  Annotations     

There is no transmembrane helices in ATY66100.1.