CAZyme Information: ATY65640.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY65640.1
• CAZy Family: GT90
• CAZyme Description: Peptidoglycan-binding Lysin subgroup

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		90266.35	4.3450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023326:2166913-2169786(+)

Full Sequence      

MDTVSFRTLALAALFLSAAESQVFLADPDGTSRSIDAPDTVSSGCKTTFGTSVKCDATLS
SIAFDGFEPTSDVLTSVCKDDCLTSLKSLQSSQKDACQTDVTTLNGIRYPATYMTDSLLF
AYSYICLKDNSNQFCAPQVDQWAAANGSASDGCKDCVLRTFQAELNSPLGYDADLSSYYS
SLTSSCGVTSYPVTSPAPYTLPANSTATSSGSPTPSSAACASHYTVKAGDDCDSVSTALS
VSTSMLQYQNSIAADCSNFPKPGTDLCVPATCKLYTLQANDTCFGISQAHNGSFSATQVI
SWNPRVNRDCSNLEVLVGTHLCISAPGDTSPPDPTTIPTTTATPTTVPTDVVDGTNHYCG
KFYKVSPGDTCGSVTVMMSISLKDFYFLNPEVNNPNCTNLLLGYSYCVKPVGDIGAYPGY
GGIVNPCINQIPLPASCVETGSVSTVSRWEFPTAAPNITDPDTLPLAAGTKEGCATYVTY
LDGARNGSSVNACYSVASVFGTNITDFVSWNPSLKYDENNPQNCVLTKGFRYCAQVTVAS
PTSTPATTTTTSPSVTTPTPTQDGMVKNCNKFYKVKSGDGCYNIADSNGVALSDLYSWNP
ALKGDCSGLFPDYYLCVGVTSSSSGTPTTTPTTTTTPPGTTPSPVQDGMVKNCDKFYKVK
SGDGCYDIASSNGIALDDLYSWNPALKSDCSGLFPDYYICVGHQSATPTTTPPPSNGTPT
PTQDGMVSGCNSFYKVKSGDGCYDIAHDHSIAISDLYSWNPALKGDCSGLFPDYYLCVGR
AGTPTTSTPPANATPTPVQDGMVKNCKKFYQVKSGDGCYNLAQSNNIALNDFYSWNPAVK
SDCSGLFPNYYVCVGI

Enzyme Prediction     

EC	-	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	5.03e-16	571	836	331	576	1,4-beta-N-acetylmuramoylhydrolase.
180536	PRK06347	2.49e-14	655	842	331	513	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	1.69e-09	655	699	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	1.94e-08	656	701	1	44	Lysin motif.
212030	LysM	2.98e-08	571	606	1	36	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY65640.1|CBM50	0.0	1	856	1	856
QPG98790.1|CBM50	9.69e-222	1	619	1	554
EHK49205.1|CBM50	5.20e-129	272	856	32	736
UKZ58866.1|CBM50	1.44e-128	272	856	32	736
UKZ90855.1|CBM50	2.33e-128	272	856	33	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BUM_A	4.79e-07	569	617	2	48	Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]
4PXV_A	5.76e-06	573	617	5	47	Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	2.91e-70	501	855	78	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	2.39e-38	306	619	207	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	3.99e-14	719	856	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.49e-13	646	702	380	436	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|P37710|ALYS_ENTFA	1.68e-10	592	836	306	525	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999771	CS pos: 21-22. Pr: 0.9691

TMHMM  Annotations     

There is no transmembrane helices in ATY65640.1.