CAZyme Information: ATY65223.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY65223.1
• CAZy Family: GT1
• CAZyme Description: class V chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1451	CP023325|CGC12	156687.48	5.6525

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023325:859904-864467(-)

Full Sequence      

MRELSDSRRRFKTTSSHTSQTYQSPRAMAQPSLLTERRLGSRSLAKDTTKLGHVQHRIGC
PTSCFEALGDTSSWYLYGGLDALKRACNSTMLLDFALFNRVDGPDAQVAIHACAASLTSS
KSTTPVLNRRSDASRCSREGVPRGNVTTSLQLSSSGSSSVTNLTDITASLDLLKAFYSSH
DSGCDEMLKFASSGNAAVGVYAGSGLADQGVLTAALDKLRTQLVKGETVAEQTVVQLCGN
STARYTFGIYIGIDGEFGRVQRALQSWKNGTCVATEAAPVRWEPVTFASPLAVSASFGGA
NATTVSHGSFSGSKGLPRSPATLTGRGDRDGCSPIQVEAGDGLETLARECGLSISQFAQY
NPGATHFGKYLLGQRLCCSASGAAGANERRALAPDSDGYCHSYLVKMGDSCSALSATYGI
KNDDIEEWNKKTWGWNGCNKMFAGYYICLSKGYPPRPAPVKNAVKGTGRYPHDIDPASLN
ACRLKACCNIWGQCGTTGEFCTPSKSPTGAPGTAAPGENGCISNCGTDVITGHTPKDTYT
IAYFEAYDWDRPCLRMAADQIDASKYTHAHFSFAVLTDDLSISVHDTATQFNLFRSLTGI
KKIVSIGGWAFSTDVATYKIFRSAFRGEVNRGKLIDNVVKFLTDNDLDGVDWDWEYPDEP
DIPGIPPGTLDDQVGFYLFFQQLRKKMPEGKTVSVTAPASYWYLQHFPIQGISLVVDYIV
LMTYDLHGQWDYTNKYSSSGCGSYEQGLGNCLRSHVNLTETINVLSMITKADVPSDMIVV
GVSSYGRSFQMSEAGCWTEQCTYTGPESGAYKGRCTGTAGYISDFEINEILAHSPSAQTH
LDPGSYSDIVVFNNTQWVAHMSPQNKDFRKLLYKGMNFLGTADWAVDLQSESGEGPDEAA
DSHKTIYIDPKIWQSATQLVTAPPGATLVWPPMPLASPTTITFEPWSTVVSYSSPTIKTT
TRSGITSTYPAYVYVTWHTVLSIPPLVTTAIPVWGVTLNNASSTGGGPIILTSSVQPPPF
TVQVTPIIDGTTSIINPTSTSTTTPAAIIWGTKTYVPPVETETFGKSTIIIGGRTLLPTG
VTVTPHPYPSSKPTPGTTDPVLNSKTPTWKSGKVPEPTAQPDCHDCGRPCLLWCDSDCPF
CPPSVFGGQGGGGSSGGDLDDPDDPDRPDGQHTIMFDGLLSEDVAPATFEPYDVAISVAD
VQHSWFESVWQDYLFPHQGPETTLSIQPATRTPYARCAISDSFLFWTFSVYDIEGWATDG
GTKLHQEENGCGALTGWSWQAETDEKSTHVVFNLPFFIKDGCVERAIVSAGGPAISCEAD
ELFQLHDRQDRAPATRETASAMATWSSRVAKMGSGKANDRPPPVPYTTEEMEAFARFYIS
IQPEIVNMGVHPHYVPMDWGTAGAARYGQDNEACLPLPPGLSSTRYVSHLSRRGLVGQAT
TKWFPLRVDQS

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	540	890	7.4e-43	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	0.0	539	889	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	5.92e-50	541	888	3	333	Glyco_18 domain.
395573	Glyco_hydro_18	3.66e-42	540	887	2	305	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	4.66e-33	541	726	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	4.67e-31	559	790	19	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY65223.1|CBM18|CBM50|GH18	0.0	1	1451	1	1451
UKZ53593.1|CBM18|CBM50|GH18	0.0	44	1317	66	1309
UKZ79393.1|CBM18|CBM50|GH18	0.0	44	1259	66	1237
AAS72549.1|CBM18|CBM50|GH18	0.0	44	985	63	988
AIT18879.1|GH18	1.01e-240	502	846	58	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Y29_A	3.19e-25	541	912	10	377	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	3.86e-25	541	912	10	377	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
5Y2A_A	1.23e-23	541	894	6	353	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 [Ostrinia furnacalis],5Y2A_B Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 [Ostrinia furnacalis]
5Y2C_A	1.31e-22	541	894	6	353	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 E2180L mutant in complex with PENTA-N-ACETYLCHITOOCTAOSE (NAG)5 [Ostrinia furnacalis],5Y2C_B Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 E2180L mutant in complex with PENTA-N-ACETYLCHITOOCTAOSE (NAG)5 [Ostrinia furnacalis]
3WL1_A	5.03e-22	541	893	10	363	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.58e-81	332	909	193	740	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P36362|CHIT_MANSE	8.49e-22	541	893	26	379	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q95M17|CHIA_BOVIN	6.01e-21	541	893	25	369	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q6RY07|CHIA_RAT	2.53e-19	541	926	25	410	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q9BZP6|CHIA_HUMAN	3.45e-19	543	893	27	369	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATY65223.1.