CAZyme Information: ATY65116.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY65116.1
• CAZy Family: GT1
• CAZyme Description: GPI-anchored cell wall beta-1,3-endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	CP023325|CGC16	45957.19	4.5224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023325:2653913-2655280(+)

Full Sequence      

MPSSSSILALATAITGATAAFTGFNYESKGKDQAGFEAEFKNAQGLDGTNGIFNSARLYT
MIQDGTVSDPITAIPAAISTKTSLLFGLWASAGQAQFDNEISALKKTAQQYCDKLDGLVA
GISVGSEDLYRDSPIGQAAGENPGAGPSVLANYVQQTRDAIKGTCLEKAPIGHVDTWTAY
ANSTNRALSDKLDWVGMDAYPYYENQKDNGIENAEKLFQAAIDNTNTGTGGKPLWITETG
WPVSGKSENKAQASVDNAKTFWRDVGCPRFGKVNTFWFIMQDGGPSQSDKPSFGIVGGST
LSTKPLFDLSCDGYTNGGSGSGSSSSSSSSSQQSSTSASGSQSDTTATATATSQQSSGAS
TVSDASSTLSTSAAGSGSSSSSGSVPVPVGTGGLVPSHVQPSGTGTGAGTGVVPSRTPTS
PSGSSTPTPIGSNAAAGLNSVAAAVAAIFVAVAAF

Enzyme Prediction     

No EC number prediction in ATY65116.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	99	295	4.8e-18	0.7491961414790996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.44e-19	75	278	94	279	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.12e-06	174	282	157	281	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY65116.1|GH17	1.10e-241	1	455	1	455
QLI63758.1|GH17	1.33e-147	5	312	3	313
QUC20672.1|GH17	1.35e-144	6	316	3	316
UNI21974.1|GH17	4.54e-144	1	312	1	315
QPH12219.1|GH17	3.94e-136	5	314	3	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.48e-17	73	305	83	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.12e-16	73	305	83	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	9.45e-108	7	311	7	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	1.68e-106	7	311	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.90e-106	7	311	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.12e-105	7	311	6	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.20e-104	7	311	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.862101	0.137911

TMHMM  Annotations     

There is no transmembrane helices in ATY65116.1.