CAZyme Information: ATY64613.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY64613.1
• CAZy Family: GT71
• CAZyme Description: Glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		74015.24	8.7881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023325:2941962-2944204(-)

Full Sequence      

MAMGFLKKASRLALLVSAASTLFLFLSLYHILSPSIASPERLKAAADTVDHCHTPRNNTK
PRIPNKIHQIWKDKDLSTYPLTASTGAWESTFENKNYTIRLWTEQDIVNLVKASYPWFLS
TYESYKYNIQRADVARLMVVHHEGGLYADLDAHPSPDTSAESINCLQSLGYQVIIAPTSE
DRGISNHFFMAERDAEFLLWALHEAKKRATSLSGRFMLPYVAVFWSTGPMMITSVMNEYA
WLYNQASETKSMAVLKDSFLHSFLHHAAGRSWHGSDGRALNYIADHFNDVLAPVLLFLVA
VATAVILARRWGQVRPHIYNIVPYQTPEVMASPPSQSHGSHQPIELKNDTLPSWLRFRIW
ASQFLYRGRNRGGNRRNIVRLPFGKVAKLWTTMNELAAMEYVRQHTSIPIPKLYEVYRHK
NGTISLVMEGLPGNGSDYARMGPREVEAFGRELSGYILQLRSLEPPEAGFVGSVTGGPLV
DHRVGHIPFGPFHSVANFHFYLRLGSRLQDWTKGEVVKRVHAESHNYKVKFTHADLNPRN
IQYYKGKIVGIIDWEFAGWYPEYWEYTKMLWADAPNYEPFFRAVEGEPSIEKYREEIEAE
RDIWRLISHWRYDDYYGEQEKRDAVYAALGEDVARKASMQQALQTT

Enzyme Prediction     

No EC number prediction in ATY64613.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.63e-19	63	354	82	338	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
270690	APH_ChoK_like	1.00e-15	378	571	24	154	Aminoglycoside 3'-phosphotransferase and Choline Kinase family. This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).
398274	Gly_transf_sug	9.32e-11	86	154	6	79	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
396281	APH	1.75e-09	378	583	24	222	Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.
270702	HomoserineK_II	6.71e-04	533	561	183	211	Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY64613.1|GT32	0.0	1	646	1	646
UQC87643.1|GT32	2.04e-83	54	313	62	323
UNI15388.1|GT32	1.98e-82	57	310	51	302
BCS10670.1|GT32	1.74e-81	47	312	22	286
BCR98326.1|GT32	4.52e-81	47	312	52	316

PDB Hits     

ATY64613.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	4.12e-26	27	291	27	280	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.16e-21	53	287	47	269	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	4.21e-20	60	297	51	276	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.08e-19	63	297	62	284	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.03e-18	60	291	79	300	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000000

TMHMM  Annotations     

Start	End
12	34
221	243
290	312