CAZyme Information: ATY64150.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY64150.1
• CAZy Family: GH55
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1550	CP023325|CGC18	170050.21	6.5306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023325:133494-139223(-)

Full Sequence      

MRINALAWSALLVFSAQTKASAREAHGGIDQTFAVIDNFVEEWKVKYPSLDKEKISDIHA
TAERMKDGLINPPPPPPRVTVPVSKPTDVPLPDTKPFGSLMTNGTSGPYSANSTKLERAR
QIVRQAQQEADTRNQERFANPRVNNYYHSHGSGAKRARALDNASLRINATVTAAAAILAE
ANEANATTVDHSKYALPLDIASKISQLDGDSYLAKRSPPGSKSFWMETITHDGRVPFGGS
STSGYKVFRNVKDYGAVADGKTDDTDAINKAMSDGKRCGADCGSSTIKPAIVYFPSGTYR
VRQTIPMFYNTQVVGNPNDMPVILADRNFIGLGVCHLMSTLVAMEVRMSGTSTRSLTKFP
KKNNFFRQVRNLIIDTTKVRMKGVAGLHWQVAQATSIYNVRFFGSTDRSKKHIGIFAENG
SGGFMGDLVFSGTTIGIRCGNQQFSSHSLAFFNVGTAVDLLWDWGWTWKNIYIFNSDVGF
NMNGDFMGGSMMLLDSHFEFVNLGISIGTQKGSTDQQEFSMTLENIAMTDVKTMAVHKAS
NTFLTGGSSKISSWMIGKVYDKANADGSFVKGQYSKMANRDQSLVMTNGVASNGYFIRRK
PQYEDKPVDYFMTAHPTAKGDGVTDDSFALSLVAAVAMSKKIALYIPMGSYIVSQPILFP
PGSVIVGECWSQIVAKGDRFGDASNPRQVVLVGNQGDTGSVEIQDLLVTVSGPTAGAILM
EWNIAQDKQGSAAMWDVHFRIGGAAGSNLEASNCPKLSGSVNKKKCIAGSLMLHMTAKSS
GYLENVWAWVADHELDGGPSQTQIDVYVARGILIESGKGPVWLYGTSSEHSVFYQYMLHD
ASNVVMSMIQTESPYYLPDPRAPEPFKQVARFGGDPDFSDCASSGPHCAAAWGLYILGST
NIHVYGAGLYNWFQRYTQPCVDSQNCQQRVVNVRNSGQVWLYNIYTIGTVEMINHETDKP
ILAKPNTNTNIHPFTSVINAWLRASTGHGSSDRDDDDDDDTKEYVSPVVCDALYTSLEQM
EASYDHIQDRCISKYLAQAFARNLTSSREKYNKVINNDYPSKFKIYHDVIKEQSIYQIKK
YMLDDKAVGWSCGRPQPKKCCNECSNSGGNYMDPVCFHLSCFGSDEGSRTKCSSGEDKKV
ACPTVVGDYPGRYHWDLDDKDKFFDNLEKHYGVLQGWVEFIDYDVHYNYGCVWGQTESDP
RNMAQCAKDSDVFWTNYPALKHDFDLKDPSDIMKAAYDSVTRLIAETEIQMTAAADGFGS
YADIASTLMLPAMSMSSAVKNMEGIVKIADQKIAQDREEGIATIITSIFFFIPFVGEAAA
AVGVAVLRTIIDLAGAFADIGYSIYDSVKHPDDLMGNLFGMLFDAPVMGAAFRQIGKEWR
AMKQEKIDTLPETFINDVKRTRKMQAMCNLPSTPIDGMEKFQRRGSLSTYLSGRVTKTSP
AAFKRDEQRTAAVGVMSTIFAAASVTAYSTSTACLTLGHLYPRGTDVSVRANVELLLETL
AAEATHTGEWVNVVGYVTSVGGGTAAVQALMVWPAGPMDVQQYEAALEDI

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	221	970	2.7e-243	0.9743243243243244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.38e-74	248	481	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403757	Ten1	5.33e-16	1463	1548	31	115	Telomere capping, CST complex subunit. Stn1 and Ten1 are DNA-binding proteins with specificity for telomeric DNA substrates and both protect chromosome termini from unregulated resection and regulate telomere length. Stn1 complexes with Ten1 and Cdc13 to function as a telomere-specific replication protein A (RPA)-like complex. These three interacting proteins associate with the telomeric overhang in budding yeast, whereas a single protein known as Pot1 (protection of telomeres-1) performs this function in fission yeast, and a two-subunit complex consisting of POT1 and TPP1 associates with telomeric ssDNA in humans. S.pombe has Stn1- and Ten1-like proteins that are essential for chromosome end protection. Stn1 orthologues exist in all species that have Pot1, whereas Ten1-like proteins can be found in all fungi. Fission yeast Stn1 and Ten1 localize at telomeres in a manner that correlates with the length of the ssDNA overhang, suggesting that they specifically associate with the telomeric ssDNA. Two separate protein complexes are required for chromosome end protection in fission yeast. Protection of telomeres by multiple proteins with OB-fold domains is conserved in eukaryotic evolution. Ten1 is one of the three components of the CST complex, which, in conjunction with the Shelterin complex helps protect telomeres from attack by DNA-repair mechanisms.
403800	Pectate_lyase_3	3.44e-06	618	760	9	155	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	0.004	198	299	32	124	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY64150.1|GH55	0.0	1	1550	1	1550
QUC21084.1|GH55	0.0	24	1410	31	1382
UKZ74106.1|GH55	5.20e-204	110	979	66	927
UKZ47543.1|GH55	1.61e-203	110	979	66	927
EGX49162.1|GH55	4.53e-201	110	982	423	1269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.63e-174	224	985	6	756	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	7.79e-169	224	983	26	757	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.71e-158	221	953	40	849	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	3.92e-141	224	975	48	780	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.01e-49	264	930	71	708	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999683	CS pos: 22-23. Pr: 0.9431

TMHMM  Annotations     

There is no transmembrane helices in ATY64150.1.