CAZyme Information: ATY63993.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY63993.1
• CAZy Family: GH5
• CAZyme Description: UDP-glucuronosyl UDP-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	CP023325|CGC8	56295.37	8.4279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023325:4041664-4043350(+)

Full Sequence      

MHIALLTNPASGQANVHFATAQELVSQGHRVTFLSAESCGSKVSRFRQCQPLSRQSLVHF
ISLGSAQIIQDYTKLAQVELSTMQGEPGSIRSLLTGINGAFGPSEIYADVAYKVSATLEE
LDPDMVCVDCFSSPYIHGTRMAQRKHIVFVPCSPGLTASRGSFIPYPIAGNRKRSWGTLF
ENAVLQAHEFVHSRTDAKRRAKRRLLLKGFKLKSFGHSEDTWILPPYWKDDNCVAGVHFN
TLGLADCPEQPSKLAFVGAGLCPDMSPVSSDPDEDVTWMNQALALQEDVVYMNMGSMFIW
REEDFWNCMRAFQYVSEKLQGRVRFLVKINSPMAAVTDASLHFTIPQKDLPACVRLTHWV
KNQAAIYSHPALRVFIHHGGGNSFNEAVHFGLPQLVLSQWFDTHEYGYCAEKFGLGFRSR
RPPAIERRDVESKLLRMLGTEWPVYKENCMAWAVRSQIGGGAAAAARLVLAHAEQGSRSV
SSQSSRKSSMCYLKEERFHEKTLV

Enzyme Prediction     

No EC number prediction in ATY63993.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	116	473	6.5e-17	0.7591623036649214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.78e-29	1	450	1	383	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.62e-10	1	451	2	380	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	3.13e-05	363	452	347	442	limonoid glucosyltransferase
177830	PLN02173	0.001	363	456	327	428	UDP-glucosyl transferase family protein
223071	egt	0.004	344	416	338	409	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY63993.1|GT1	0.0	1	504	1	504
BCS27825.1|GT1	8.18e-172	1	474	1	491
EAA58772.1|GT1	1.75e-129	1	474	1	439
SJX63359.1|GT1	1.74e-109	1	469	1	562
CBQ73522.1|GT1	1.74e-109	1	469	1	562

PDB Hits     

ATY63993.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	1.04e-110	1	473	1	562	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	2.67e-108	1	473	1	563	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	6.38e-11	3	436	8	436	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	5.25e-07	120	439	137	467	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000052

TMHMM  Annotations     

There is no transmembrane helices in ATY63993.1.