CAZyme Information: ATY62702.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY62702.1
• CAZy Family: GH20
• CAZyme Description: lipolytic G-D-S-L family

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939		100905.22	4.8942

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023324:868181-871791(-)

Full Sequence      

MTLTRPIAIIATVSTSSRLKPPSLDKAYSMRLRWASMAAVLPTSLALPAPAPDTSIVLHF
KGTPAGNQIENRRELRILPVGDSITVGYGSDEGGDGDGYRRKLRDDLSGNKVIFAGTETT
GTMDDGYFAAWSGKTIQFISDHVDPSLDQRPNVVLLAAGTNDMNPDPSISTEGNDPVQAA
LRLGRLVDKIITKCPGAVLLVAIITDTCDPAQAPATRQFQKLVPRVVQQRRDAGHRVLAV
DFTSFVRDNGKEVLRDCIHPTNSGYRLMGDYWYDFLTQVPGGWIQPPVGGDPQRPAHDDP
GLNGGIDRHVPPPDYGQSPVDSRPDGRYKDVRDWAVAGPAKCGSKPAWRATGKIAHGLGR
NGDWKFHKYWTQVGEVAAGFGLDSAHVRLHDMNGDGKADYVWIDPNTGEIRCWLNNLPKP
WSPAGTNNSIIGSGAGRGETVYLADMNGDGMDDYLVVNPRNGAVRVYWNRGPDSRWANGW
KFVDGGVIAAGVPHANLATLRFPDINGDGRADYVYIGQGGSLVHWLNVGSVGGTDVVWHS
QSGIATGVGLEDLSRLIFADLNGDGRDDYLVYDDDGGISGFLNQRTNREGVPLFIDQGGA
RSIMDGFGHAPSTLRLADMDGDGKDDYVFIGDNGSLSVWYNRGTTDDSMAIDGLRFADIT
GSQGKDYIWVDPKSGAPIVYSNNGDSWSPVNNGHAIAAGAAPGSQVVFGDIDGDGYDDYL
VLDPETGALTAHLLVPGGGGESQYGGYVFKPVGQIASGLGPGKNVRIADIDGDGRDDYIY
LSSTGKTTIYRNMYGPDTGPDNRYSALPEADALGIGQRPEEISFHDINGQVSSPPLPTAF
AFDPLTEIFFFCSDGKADYVWTRPLDGQVEVWLNMYPQQPAWRHVGVVKDGVGTSGANVR
FAALTGTRKHRGSGRADYVVVDPSSGAFAAWLNGCDDRV

Enzyme Prediction     

No EC number prediction in ATY62702.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	75	276	1.1e-41	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.74e-38	75	276	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	7.00e-11	80	267	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	8.48e-11	77	275	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404411	VCBS	5.57e-07	391	456	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
404411	VCBS	8.69e-06	504	571	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67685.1|CE0	0.0	39	937	447	1312
QGI80975.1|CE0	0.0	39	937	447	1313
UQC90643.1|CE0	0.0	58	935	342	1204
UMZ45332.1|CE0	0.0	50	935	466	1327
QPC64279.1|CE0	4.78e-291	52	937	25	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	7.12e-18	73	279	4	198	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]
4TQJ_A	4.70e-07	376	643	100	368	Chain A, Lectin 2 [Cyclocybe aegerita],4TQJ_B Chain B, Lectin 2 [Cyclocybe aegerita],4TQK_A Chain A, Lectin 2 [Cyclocybe aegerita],4TQK_B Chain B, Lectin 2 [Cyclocybe aegerita],4TQM_A Chain A, Lectin 2 [Cyclocybe aegerita]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15329|GUNX_ACETH	6.81e-08	150	279	25	140	Putative endoglucanase X (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.945868	0.054132

TMHMM  Annotations     

There is no transmembrane helices in ATY62702.1.