CAZyme Information: ATY62242.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY62242.1
• CAZy Family: GH18
• CAZyme Description: mannosyltransferase (PIG-M)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	CP023324|CGC11	48841.48	10.1342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023324:1515128-1516566(+)

Full Sequence      

MAQRTAVSAQNGSFRSLQVLFDPVPLFSIAAALRVALLLYGAWQDAHSAVKYTDIDYLVF
TDAARFVAAGGSPYARDTYRYTPLLAWLLLPTAHRRLFDFGKVAFAVADLVAGWLALRLL
RRRQGGGMSARRAGAFAAIWLWNPMVATISTRGSSEGLLGVLTMALLWAVERRRVSLAGM
LLGLGVHFKIYPFIYAPAIVWWMDEDRMSGGAVGKTTKKNPALVDVAINFVTAARVKLAV
ISLATFMLLNLLMYSIYGTPFLVHTYFHHVTRIDHRHNFSPYNVLLYTNSATPTDTASAS
SLRTESLAFLPQLLLSCVLIPFALAKKDLATSMMAQTFAFVTFNKVCTSQYFLWYMIFLP
LYLPGSSMLRNPKLGISALVLWVVAQAAWLHQGYELEFLGMSTFVPGLWLASLVFFLVNC
WILGIIISDGARGLSGKIHVE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	149	427	4.8e-97	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.03e-81	40	427	25	415	GPI mannosyltransferase
252941	Mannosyl_trans	3.22e-79	149	427	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY62242.1|GT50	0.0	1	441	1	441
UKZ48798.1|GT50	3.38e-218	17	440	6	415
UPK97783.1|GT50	4.52e-218	16	441	3	424
QKD53244.1|GT50	1.40e-216	25	441	12	422
UKZ90890.1|GT50	3.72e-215	16	439	5	414

PDB Hits     

ATY62242.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	1.11e-213	25	441	12	422	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.02e-179	17	432	19	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	7.37e-174	23	429	8	427	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	7.88e-174	23	431	8	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	7.90e-174	21	429	5	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997344	0.002679

TMHMM  Annotations     

Start	End
20	42
103	120
181	203
241	263
306	325
340	362
374	390
405	427