CAZyme Information: ATY62233.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY62233.1
• CAZy Family: GH18
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633		68352.78	7.0624

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023324:5612129-5614185(-)

Full Sequence      

MARKYKNPMTNPLHYATPQLLTGAPATYTTAQRKLLGYDYVIVGGGCAGCVLASKLSEDA
DVTVLLLEAGGPHTGILESRVPLLFSKLFHGEHDWDYSTVEQPGLAYRRMFWPRGKVLGG
STSINAMMYHHGSKSDYDEWAGALGCAGWSYADLAPYLRRMENFTANPARPAIDLQHRGS
GGEWQTGYSTLSPMVERGFLPACAEVGIPANPDINTEAGTLGVTRFQTFIDSKGERSSMA
TAFLTPEVLRRPNLYVGCHAHVTRVLYDRLDSDKEPAAIGVELMTKRGGERYEVHARREV
ILSGGAVNTPQTLLLSGIGPAAELGRLGISVVKDNAAVGRNMKDHLCPTGVVLKSKTAHT
YDYLNDNIKAIPALLRWLVTGGGPLSSNVGEAAAFIRTVDHPSPATKPENRPKDYSSGGV
GPDVEILGAPIAFIHHGEEQAPAGAGIFSVGPCLLRPQSMGTITLKTDDPFDHRTNKPAL
IDPKYFSDEGDNDRKVMLAALRLAIKIANSAHWKEFVEPIARNDSPGHLWWPSSSSDPDS
ISDEQLLAFMKEKAFTLYHPVGTARMGPVEAGNSVVDLECRVHGVGRLRVVDASVFPEQI
SGHPTAVIGAIAYKMSDVIKKTFTPAGPPLANL

Enzyme Prediction     

No EC number prediction in ATY62233.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	621	1.3e-167	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.78e-135	38	620	6	532	choline dehydrogenase; Validated
225186	BetA	1.44e-123	38	626	8	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.43e-50	39	619	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	3.24e-38	108	347	17	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.40e-36	457	615	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY62233.1|AA3_2	0.0	1	633	1	633
QMW44376.1|AA3_2	8.11e-307	1	633	1	628
UDD57318.1|AA3_2	8.11e-307	1	633	1	628
QMW32344.1|AA3_2	1.63e-306	1	633	1	628
QRD83803.1|AA3_2	1.63e-306	1	633	1	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	9.54e-73	38	619	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.33e-72	38	619	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.33e-72	38	619	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.85e-72	38	619	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.90e-72	38	619	24	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	1.81e-124	21	620	18	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|P64264|Y1310_MYCBO	1.65e-98	39	620	6	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	1.65e-98	39	620	6	527	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	1.65e-98	39	620	6	527	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.55e-78	23	620	26	572	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ATY62233.1.