CAZyme Information: ATY62147.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY62147.1
• CAZy Family: GH18
• CAZyme Description: O-mannosyl-transferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	CP023324|CGC29	86772.84	9.1297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023324:7933551-7935969(-)

Full Sequence      

MAAPAPPQGSLRQRNAASVKKPTDAAAAHDNQELDKLVKAAKAHKKTGIEWDHSIALTVM
TVLGFITRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFAKLLFAFMGWLVGYN
GHFKFENIGDSYIDNKVPYVAFRALPAILGALTVSVTYLIMWESGYSVPACLVATVLVLL
DNAHIGQTRLILLDATLILAMACSMLCYIKFYKQRHEPFGRKWWKWLIFTGFALSCDMST
KYVGTFAFVAIGSAVIIDLWELLDIKRVGGALTLPVYAKHFSARALGLIIMPFIFYLFWF
QVHFSILSRSGPGDDFMTPEFQETLSDNIMLANAVDIQYYDSITIRHKETKAYLHSHPEN
YPLRYDDGRVSSQGQQVTGYPFNDTNNYWQIIPSSDDKKTGVNVLNNAVVRLKHVSTDTI
LLSHDVASPYYPTNQEFTTVSIEDAFGTRANDTLFEIRIEHGKANQEFKTVAGHFKLIHF
PSKVAMWTHTKPLPEWAHKQQEINGNKQVPPSSNVWIAEDIPSLDPQDARREKVARKVKH
MPFLQKYFELQRAMFYHNSKLTSSHPYASHPYQWPLLLRGVSFWTQNDTRQQIYFVGNPL
GWWFASGLLAIYAGIVLADQISLRRGIDALDRRTRSKLYNSTGFFWLCWATHYFPFFLMG
RQLFLHHYLPAHLASCLVAGALVEFVFTTGAAPGTDRPGQKHLTAKERFGGQSLIGVWIA
SGVITAVIAGGWYFFLPLTYGYPGLSVSEVLARKWLNYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	60	304	9.6e-71	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	52	764	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.11e-82	61	308	4	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	5.42e-78	545	757	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.34e-18	355	503	13	170	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.76e-08	336	394	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY62147.1|GT39	0.0	1	764	1	764
ALJ52589.1|GT39	0.0	7	764	7	765
QLI73135.1|GT39	0.0	7	764	7	765
ANH56534.1|GT39	0.0	7	764	7	767
QPG99538.1|GT39	0.0	1	764	1	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.37e-97	40	757	36	725	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	3.15e-93	8	757	20	749	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	1.51e-257	10	764	4	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	4.80e-245	50	764	49	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	4.15e-237	55	757	60	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q99PR0|POMT1_RAT	3.71e-107	52	755	36	736	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
sp|Q8R2R1|POMT1_MOUSE	2.05e-105	52	755	36	736	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999695	0.000306

TMHMM  Annotations     

Start	End
53	72
97	119
140	162
190	212
285	307
600	617
638	656
671	693
714	736