CAZyme Information: ATY61914.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY61914.1
• CAZy Family: GH17
• CAZyme Description: glycosyl hydrolase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		97198.06	6.0745

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023324:1699554-1702179(+)

Full Sequence      

MVPRTVIPIDKNWQFKQADKEGGDEYRAVSQFPTNVHLDLMHHDLIPDPFIGKNETDVQW
VGEAQWTYRTTFASPKVATGAKVILAFEGLDTFATVTMNDKVILETDSMFIPERVDVTTH
LSHSDENELVITFDSAYLRGWSRVEQCPEHIWSCWNGDSSRLAVRKAQYHWGWDWGPSLL
TCGPWRPVNLEIYDSRLTDLYMSIDIDESLKRAKVIAHAATEGTAATHVRIDVSLNGKEV
TSETIPAANTASVTFHISNPELWYPIRYGKQPLYTIKATLLSKGTTVDTMSKKIGLRRAR
LVEHQLEDQPGTSFFFEINSIPIFCGGSNWIPADNFVPRISPKRYRDWVKLVADGNQFMI
RVWGGGLYEEAAFYEACDEMGILVWHDFMFGCGNYPAGPKFLTSIDREARVNVTRLRHHP
SIVLWAGNNEDYQLAEQENLGYDPKDMNQDNWLKSKFPARYIYEKLLADVCKDLIPDVPY
HYGSPWGGNGTTDPTIGDIHQWNVWHGSQEKYQNFDKLVGRFVSEFGMEAFPSVKTIDAY
LPQGKNDLDRYPQSSTIDFHNKAAGHERRLALYLAENIRYGPDPLEQYVYSTQLMQAECL
ASAYRLWKREWRGPGREYCGGALVWQINDCWPVTSWAICDYYLRPKHAYYTVKREMAPIS
IGMTRRDHQYPKDKYTRAYIDTKIKVEIWGSNLMLQDLTVDCVVKAWDVETGEETFSKKV
VSSLVLPSNRSTEIYAMDVPVSTPKTGLESRTVVASYLLQNGKQIARYVNWPEPLKYLHL
QKPKHLTAELSSDATHVAVKADVPVKGVAVECEQDGVTFDDNLVDIVPGEVVHIGINGAS
QGTVITTRYLNMLS

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	751	3.8e-95	0.7021276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.71e-81	1	653	7	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	5.00e-15	685	777	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	9.26e-11	196	297	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	1.72e-08	13	430	19	417	beta-D-glucuronidase; Provisional
407625	Ig_mannosidase	0.003	782	844	1	64	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY61914.1|GH2	0.0	1	854	1	854
UQC87618.1|GH2	0.0	1	854	26	877
AEO69937.1|GH2	0.0	1	853	1	851
QLI64588.1|GH2	0.0	1	853	1	852
UNI23282.1|GH2	0.0	2	854	10	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.72e-142	1	667	21	664	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.09e-125	6	830	8	810	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.14e-125	6	830	10	812	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.17e-125	6	830	10	812	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.07e-125	6	830	8	810	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	1	853	1	855	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q0CCA0|MANBB_ASPTN	3.86e-278	13	838	13	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1CGA8|MANBB_ASPCL	1.41e-273	7	842	7	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	4.00e-273	7	842	7	834	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	4.00e-273	7	842	7	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATY61914.1.