CAZyme Information: ATY61836.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY61836.1
• CAZy Family: GH16
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A2H4SFF1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
917		103399.89	6.5650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023324:1036847-1039706(+)

Full Sequence      

MRFFKSQSPTLGEPGLQTPSSRPPSRSVASMRSSNSHSDNGNKTGTSTPSRLQYSDDFRY
RTMANYIYNSIMVSGWIHPNAAQDPNNIHGVLIRRARGQYLSVPEPVHPVLHEAVSRMNL
AVAITIRPRLLEGIMMTLTEGQTELRLKDGSQLQVIDSLNHAHPTTVKKYQYACICQQER
MLLVWHDDISHVLSHAAHLEEKLLTMIWGSGKVATTVLSSPFRTPSILSGHTPSGYNTPG
NVITEKEAYIAPAEEADEEVAAEKEKAMERPESLKRPVMRTSAVFIGLAMAVTIVLLVGV
YIGRLVSECLLDGTWVRMALVFPIPLLFCVSLFFFQIVFSDIFQMLGPIGGNTTNSRYFS
CHKPSVERAYAAGMELPKVTIQMPVYKEGMDSVIIPTIRSLQQAVSFYESHGGSATIFVN
DDGLRAGLTDAQVRQRQEYYHNNNIGWVARPRHNGDEGYVRKGKFKKASNMNFALNFAQR
VERRMQDMMDTRIAATGSDLVDEAEEEELYHTALAQLLDEEPLAWAEGDIRVGEIILLVD
SDTRVPIDCLLYGAAEMYLSPEVAIVQHSTGVMQVTHDYFENGITYFTNLVYSSIRFSIG
AGEVAPFVGHNAFLRWPAVQDVGRLEQDGAYTAYWSESHVSEDFDIALRLQMKGSVIRIG
SYHNDEFKEGVSLTIYDEIMRWQKYAYGVSEMIFHPLHRWIYRGPFTPLFYTFLFSNIMW
SSKISIISYMCSYFALGSALLLTCLNYFLIGWIRDELASAYLTSWNVFLSLIVVFNGAGP
IALAILRYRTGERGLVGALFENYKWMPLMTVFFGGLSWHITLALLAHLFHIDMQWGSTSK
EKVDSNFFQEVPRIFKTFWTMYVFITIMVVAMIYLGVFAPPNWAITDFSAIVPLALNLSF
HALVPFVLNPSLMVFAY

Enzyme Prediction     

No EC number prediction in ATY61836.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	535	745	4.8e-49	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.18e-44	535	750	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	9.47e-11	533	835	138	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.96e-09	381	643	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	8.71e-05	532	729	84	278	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY61836.1|GT0	0.0	1	917	1	917
UNI18966.1|GT0	0.0	23	917	16	905
QLI74022.1|GT0	0.0	43	917	30	902
QUC19563.1|GT0	0.0	54	917	49	911
ANH56600.1|GT0	0.0	54	917	44	909

PDB Hits     

ATY61836.1 has no PDB hit.

Swiss-Prot Hits     

ATY61836.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000007

TMHMM  Annotations     

Start	End
283	305
318	340
700	719
732	754
764	786
807	829
857	879
892	914