CAZyme Information: ATY60851.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY60851.1
• CAZy Family: GH128
• CAZyme Description: Glycoside superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		81478.45	5.3530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023323:542586-544865(+)

Full Sequence      

MWSSLFVSGLLLVDTALGQLPGIPTVPFEAADGNKTFSLGSVSTVIIDAKFAATTDKGGL
TLIPPTLRAFGTTFAQDLQELLNKTVTAQDGDQRGPNTIFLTIDGDGEFLDAAGRPTTEG
YAIAVNEDGVTIRGASALGAWWGTRTLLQQAILGDGAVPVGQGRDAPGWSTRGMMLDCGR
HWYPPAFLVDLCAYMSFFKQNTFHVHLSDNTIVPTYTPDNYNDTYARFRLWSDSSALAGL
NRHPNESYTKDDWDDVQTGCARRGVTVVPEIEAPGHCLPIVQWRPQIGYQGDLSLLNISH
PDTMPTMKTIWKEFLPWFHSSVVSIGADEYKGPEEDYKKFVNEMAAFISAEASKSVRIWG
TFPAVAHPGSPTTIAANITMQHWAYLFDNPYEDYIKNNYSVINSDEMYYVVMKDGPYGRA
INTSTTFTGNPDGHGPWYPHIFNLSDPRQNPARDNKLVQGAIAPLWNDHGANTSVYSEAY
YAWRDGIPALADKHWGGNLTQHQYAAWLSKLRDRIPDQDLERRIPSKQGTVFSYDFRSVQ
GESVADRSGNQYDANTTCQATGDGMTVSPDCAITTPWLSKGRNYTLSLTLRIDTLSNDKN
TTLVAGSDSALMLTPNVTLFASGIYYRLNKTIPLQSWVRLELSAHGPRTFASAFDDKGRA
LFSKEEFLAEMSYYGAPLRWHEMAIEAPIHQITGWQGKVRDFTLSTGVDDAKQGGASAAR
GLPGAYLLATMLAVAMYLSL

Enzyme Prediction     

No EC number prediction in ATY60851.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	166	496	1.3e-54	0.9643916913946587

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119334	GH20_DspB_LnbB-like	3.02e-86	171	497	2	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
119331	GH20_hexosaminidase	2.40e-32	172	473	2	283	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
395590	Glyco_hydro_20	1.57e-26	172	466	4	317	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
226056	Chb	5.11e-21	119	495	206	613	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
119336	GH20_SpHex_like	6.91e-21	172	466	4	288	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY60851.1|GH20	0.0	1	740	1	740
QKX53893.1|GH20	1.97e-229	20	704	25	727
CAK43562.1|GH20	8.16e-221	2	704	3	704
BCR95441.1|GH20	4.64e-220	2	700	3	703
UJO23164.1|GH20	9.10e-212	6	704	7	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JQF_A	2.11e-39	68	496	118	547	Crystallization analysis of a beta-N-acetylhexosaminidase (Am2136) from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835]
7BWG_A	2.56e-20	105	468	71	452	A Glycoside Hydrolase Family 20 beta-N-Acetylglucosaminidase [Microbacterium sp. HJ5],7BWG_B A Glycoside Hydrolase Family 20 beta-N-Acetylglucosaminidase [Microbacterium sp. HJ5]
6JE8_A	1.20e-15	118	339	36	266	crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEA_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEB_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
7CBN_A	8.33e-15	95	311	55	268	Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZR_A	3.18e-14	101	329	190	438	Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2UPR7|H2136_AKKM8	1.01e-42	68	496	140	569	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
sp|Q7WUL4|HEX20_CELFI	1.27e-15	20	383	1	345	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1
sp|P96155|HEX1_VIBFU	4.14e-15	121	329	210	435	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
sp|B2UP57|H2018_AKKM8	6.84e-15	118	339	57	287	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
sp|B2UQG6|H0868_AKKM8	4.41e-14	95	311	74	287	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999706	CS pos: 18-19. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in ATY60851.1.