CAZyme Information: ATY60620.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY60620.1
• CAZy Family: GH114
• CAZyme Description: coagulation factor 5 8 type domain

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839		92728.52	6.5619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023323:1649520-1652039(+)

Full Sequence      

MFVSMSFSPAIYGILGAMRFALSLFAAVPPAASGAGTHFLNHTALLSGVEDPAWFSANVP
LVELPSADLQAVYYYRWSTYREHLAYTGAPHGYLATEFLHAASYGAPFGGIVAAAGHHIT
EGRWLRDPRYGRDLVDYWLAGPGQRPKPATEALNKDTRDWAHQYSFWAASAVWRRYLVTG
DRNATTAQLANLVAQYRGWDDHFSPDLGLYWQVPVWDATEYTAASYASPGGDPYHGGAGF
RPTINAYQYGDARAIAAIAGLAGAPALQRDYEQRAASLQQALQRHLWHADKAFYMHRDRD
FGRALLGDREIMGFLPWMFGVPVANASAAPFRQLLDPDGFLAPFGPTTLERRSRWYMHEA
DGCCRWDGPSWPFATAQTLAAVETLLHEYPRQEAITPADYVRLLETYARTLHKNGAPYVA
EAHHPTEDRWLYDGRDHSEDYNHSTFVDNVLAGLLGLRGRPDDALTVRPLVPPSWPYFAV
ENLTYHGRRVTVLWDATGTRYNQGRGLTVFVDGVVAARRDTLGGDGGLTVPVKPGIPVPA
PHKVNIAANSQDDPLLSRAFASYTSPFDDAMRAIDGSVWRTAVPSNSRWTSYQSPHASDH
MGVDLRRAQSVCDVRLYFYDDGDGVRIPVRYDLQYWRPDGWATVPGQKRSKAPTASNEEI
RVTFPALVTSQLRVVAPNPSPGRGWGLSEMEVWTAPVFHLRNEHSGKLMGVDRMSTAAGA
RVQQYDDNGTRDHHWQFVPVGGGWSAIENLNSGLVLAVDSNENSAGLVQKDNEGTSHQLW
KVEFEGSGLFLIRNKGSNKVAGVDGMSTNNSANVVQYDDNGTKDHLWSILPAAIEGCYS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH142	47	522	4e-173	0.964509394572025
CBM13	699	831	1.8e-20	0.675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404972	RicinB_lectin_2	3.59e-18	734	817	4	89	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	7.51e-15	696	766	13	83	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	1.21e-10	776	833	1	58	Ricin-type beta-trefoil lectin domain-like.
395527	Ricin_B_lectin	5.62e-10	697	827	2	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.91e-08	711	829	13	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY60620.1|CBM13|GH142	0.0	1	839	1	839
UNI16817.1|CBM13|GH142	0.0	31	748	13	727
EAA30896.1|CBM13|GH142	0.0	36	744	26	734
CZS73623.1|CBM13|GH142	0.0	18	747	1	726
CEF84120.1|CBM13|GH142	0.0	18	747	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQS_A	8.84e-90	54	522	653	1098	Sialidase BT_1020 [Bacteroides thetaiotaomicron]
5MQR_A	4.71e-86	54	522	653	1098	Sialidase BT_1020 [Bacteroides thetaiotaomicron]
6M5A_A	3.31e-13	54	522	305	806	Crystal structure of GH121 beta-L-arabinobiosidase HypBA2 from Bifidobacterium longum [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH9|HYBA2_BIFL2	6.74e-21	54	697	336	1051	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.367762	0.632224	CS pos: 34-35. Pr: 0.5827

TMHMM  Annotations     

There is no transmembrane helices in ATY60620.1.