CAZyme Information: ATY60251.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY60251.1
• CAZy Family: CBM50|CBM50|CBM50|CBM50
• CAZyme Description: xylanase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		43255.71	4.6727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023323:2912633-2913853(-)

Full Sequence      

MPSRQVAALLATASLFSASTAIETVDGSSCGCFLSNGTNAGYYTNHAFFDFRQLLQHAGV
PDVIDNKANVASAPSSSNFFTSDAWTSFWEVETWDNSKGAAASDRNKNTLSNDATVYMIN
SPSNIYIEKAANSSYGSGDDNAATFLTMRTKRLRDFQTAAEFQTSGAGYQFLSLRMRART
VGAPGAVTAMFTYRGDDDPAKVQEADIEILTRDPRSVIQYTNQPSDLPGQGEIAEATRNV
TLPGSVAWSDWAVHRLDWTPERSVWYVDGREAASIAFQVPRDPAAVNFNAWSDGGSWSGN
MTVGDEASLQIQWIEMLYNTTGAGKRSVAGAGQEPRIGGGSRAARTGGSHDTCKVVCTID
DAADVGKVALLSNSTGDSAAHSLQAAVGPGQLAFGWAVAAILYTIL

Enzyme Prediction     

No EC number prediction in ATY60251.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	88	316	6.9e-96	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	3.08e-56	78	316	2	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	6.87e-14	158	314	56	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	9.56e-12	44	318	15	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
395585	Glyco_hydro_16	6.17e-05	157	298	20	156	Glycosyl hydrolases family 16.
185692	GH16_fungal_CRH1_transglycosylase	7.13e-04	115	313	1	178	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY60251.1|GH16_22	2.41e-262	1	406	1	406
QLI63560.1|GH16_22	4.49e-114	4	396	2	377
UKZ63659.1|GH16_22	7.61e-102	28	396	46	407
QYS98274.1|GH16_22	1.15e-101	28	398	40	400
UKZ51547.1|GH16_22	1.69e-101	28	375	22	364

PDB Hits     

ATY60251.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05790|CRR1_YEAST	9.06e-06	157	313	175	330	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999692	CS pos: 21-22. Pr: 0.9648

TMHMM  Annotations     

There is no transmembrane helices in ATY60251.1.