CAZyme Information: ATY59959.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY59959.1
• CAZy Family: GT90
• CAZyme Description: ubiquitin C-terminal

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1070	CP023323|CGC15	117999.82	8.9881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023323:4710315-4714376(+)

Full Sequence      

MPDKSVTVVSYAAGASLAAAALIYVFGPTFAIDHDGASTKKKTIVGLRNQANDCFINSVL
QALAGLGDLRIYLIRETHRRSIEDPAVYANLVQPSLSDEDGSGGGEMPLWKIQGLQDGLV
THGLKDMIDHLNERPIAKKAISPFPFVRVLEVAFKQRISRQQQDAQEFLQIVAERLKDEY
HAGQRARLHARAAVNGSGSNSTTNSNPEQSDSEKDEKQAATNGTPDGIAASSTNGTNSQS
NSDTDSLLPSTASPQSTRPLPIELEDGFPMEGKYESHLECQTCGYKTKPREETFCTITLA
VPQVMSTSLGSCFDGIFKTEYIDDFKCEMCRLVQTVANLEHEVSRSTSESFKANALDSIA
KLNQAIRTDPEQPPEGVDLGDMRYAPKRRISKTTRMTIFPKILAIHLSRSIYGVGQMTQK
NSAKVAFPEQLPLGGLAEQRRYKLLGMVTHRGGHNSGHYEAFRRQNVPPHFPNQNTFMQS
EVYSKTPTPLSTPLIHAKNADSPAISTPDLLSPASTNGSSTPSLDSVPMPAPRSVPTAPE
PEGSSPSPSISGRDRDTDSSSLRSVAASTKSALSRLTSGSIKRAKPKRAKQHLDRWWRVS
DEKVREAKTSEVLSMQKEVYLLFYELEKRVRKRLLQTAILGLVILSVSYIVLPPDSSIRL
ALRFNAVRASAAVRGATEDRDAWLRQPAPYKLDLREDVGYLIKTGYGTRHRVPLQLAALQ
GSYGGGLLGEEGKDYVVVGDWTTVDGKDAKAIGVPVHDVLKMVREYGDGDWRAHHRLKKY
QTLQSAIQAGDEETALGIGRSVGWELDALKFAPGMELMYKTMPNKKWYLILDDDTFVVKS
TLNLLLTHLNPENPHYIGNAVGDFRGRFAHGGSAIIISGEAMRQLFRRKDVVRQAYVESL
DEKWGDRLVATTFLKLGIYLEERYAHHFNGESPEETRITREKYCAPILSFHSLRTAAATT
RVSKVVGTAIKPVRWGELMELFRPAAAARGQDHVGPADKQVRTWGLVKKASDCQRKCEVE
NSKWCLAWTYEARKEACQASPWMVPGADGAEGKVSGYNKEAVKRMQAGCA

Enzyme Prediction     

No EC number prediction in ATY59959.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
239127	Peptidase_C19F	1.58e-43	46	625	1	240	A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
395355	UCH	1.63e-33	45	466	1	275	Ubiquitin carboxyl-terminal hydrolase.
239072	Peptidase_C19	1.67e-21	156	466	16	218	Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
239139	Peptidase_C19R	4.84e-17	272	468	46	200	A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
227820	COG5533	4.74e-16	44	466	71	381	Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY59959.1|GT31	0.0	1	1070	1	1070
UPK97676.1|GT31	1.73e-152	626	1070	4	454
UNI14667.1|GT31	7.66e-152	624	1069	13	494
CCT62550.1|GT31	1.89e-151	626	1069	4	453
QGI76233.1|GT31	1.89e-151	626	1069	4	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3I3T_A	3.91e-11	45	475	4	327	Crystal structure of covalent ubiquitin-USP21 complex [Homo sapiens],3I3T_C Crystal structure of covalent ubiquitin-USP21 complex [Homo sapiens],3I3T_E Crystal structure of covalent ubiquitin-USP21 complex [Homo sapiens],3I3T_G Crystal structure of covalent ubiquitin-USP21 complex [Homo sapiens]
2Y5B_A	4.33e-11	45	475	17	340	Structure of USP21 in complex with linear diubiquitin-aldehyde [Homo sapiens],2Y5B_E Structure of USP21 in complex with linear diubiquitin-aldehyde [Homo sapiens]
3MTN_A	4.41e-11	45	475	23	346	Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor [Homo sapiens],3MTN_C Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CAQ1|UBP16_EMENI	3.31e-145	1	628	1	621	Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ubp16 PE=3 SV=1
sp|Q02863|UBP16_YEAST	1.88e-17	20	465	25	414	Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP16 PE=1 SV=1
sp|Q9UK80|UBP21_HUMAN	4.27e-10	45	475	212	535	Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens OX=9606 GN=USP21 PE=1 SV=1
sp|B2GUX4|UBP21_RAT	2.94e-09	45	475	212	535	Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus OX=10116 GN=Usp21 PE=2 SV=1
sp|Q2KJ72|UBP21_BOVIN	2.94e-09	45	475	212	535	Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus OX=9913 GN=USP21 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.801781	0.198233

TMHMM  Annotations     

Start	End
7	29