CAZyme Information: ATY59691.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY59691.1
• CAZy Family: AA7
• CAZyme Description: UDP-glucuronosyl UDP-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	CP023322|CGC4	94569.76	9.3216

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023322:3141571-3144224(-)

Full Sequence      

MFRTKSTEPGQLVLEQGPSGSVLDDGRFKIRFHSEAHSLASWYHDLQMKRSCKHPASRPT
SPEAPKADPAGFPPLNIAIHIVGSRGDVQPFIPIAQILSAAPFNHRVRICTHPVFKDFVE
EQGVEFFSIGGDPEALMSYMVRNPGLLPNRESVKAGDIGKRRDEMAEIINGCWRSCIEAG
NGMGEPVTAAFVTDPKELFIADVIIANPPSMAHIHCAEKLGIPLHMVFTMPWSPTDAFAH
PLAAMNYGGADKKMANYISFIMMELLTWQGLGDLISKFRHQKLGLDPISPLWGFHLLPRL
RVPFTYLWSKSLIPKPKDWGNYINITGFSFLPLASSYTPPDDLTAFLAAGPAPIYIGFGS
IVVKNPAELSKLLFAAVKKAGVRAIISKGWSKVGGDDVPDNIYLIGNCPHDWLFQHVSAV
VHHGGAGTTAAGIAAGRPTVVVPFFGDQAFWGRMVARAGAGPEPVPFTEMTVDSLAKSIT
TALTDDVQKGAQEMAKTIAAENGAEDTVTDFLERLASEDKLQCDLCPGRLAIWLHKKTGA
RLSGFAAACLADKGIMTPDQAKLIHHKSWYVDEGAEHPLVGMVASATGFVTAVAIASSDY
SKAWKYRPSKASAKKETASESSSERKGAVPEDKPPANGAAHIMTPSQMEISAKKMATKSL
RTVWTPQPRIERTPTFHDNCKAEWEGHERGRHGRTWYLARKTSRFGVELTKAGLKAPVAF
FWNTANGFHNFPSYGYAGIEVRRRDEVKGFGSGVKVAGKEFVLGFWDAFSGIVVLPYKGT
RDEGAKGLGKGIWRGGKGFFCGLGAAVFGLPGYTLKGFERELSKRHLTKLKAEILLIRLR
KSLQDFREATVEEREAVIDAWMAKY

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	191	513	7.5e-59	0.7670157068062827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.72e-68	75	515	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.26e-33	77	518	4	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.37e-15	77	238	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY59691.1|GT1	0.0	1	865	1	865
UPK91708.1|GT1	0.0	3	863	5	882
UKZ55778.1|GT1	0.0	1	863	3	877
QYT00238.1|GT1	0.0	1	864	3	879
UKZ81537.1|GT1	0.0	1	863	3	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.14e-77	82	515	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.34e-77	82	515	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.49e-34	75	498	1	365	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	2.01e-33	75	504	1	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1PN3_A	5.03e-27	75	491	1	364	Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	8.56e-120	72	527	190	622	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	1.35e-118	72	518	153	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|A7ERM5|ATG26_SCLS1	1.39e-76	44	508	907	1350	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1
sp|A2QNQ5|ATG26_ASPNC	1.90e-74	65	508	884	1307	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2
sp|P0CN91|ATG26_CRYNB	3.66e-74	74	543	1033	1497	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATY59691.1.