CAZyme Information: ATY59065.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY59065.1
• CAZy Family: AA3
• CAZyme Description: endo-1,3-beta-glucanase Engl1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1009		109058.87	6.9175

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023322:723179-726334(+)

Full Sequence      

MRFSTALLCGEALTLVEASGIARGHSLFSRANRPTVTKTVTILETAVSDCPVPTYTVCPE
DDLFAFAQVGASTSLRTISATPSTVVYNVSRTVKIKTITITDTATVCSLPALTGVEPQTT
GVLNTELGEPGQPTQAPLLTSSIPTLSSLPTFTSTQSLQTTPAETTPAETTPAAESSNAI
LSKVNFGSDASVAPFPLPNSTFIAGTGFATGTGGNQLRPTGSISSTGGLSSSTSLRSSTS
LSSSSSLSSSPSLSSLSNTTSISTPVPSSTSLNATDPTTSTTSTKEDWDSSAMELGDIFT
VPIDIKPLPRQFSSRPDHPVPRTGIQTRGPLQTNKFYSNLFLGNQRDPVYTYPYSVSWVD
GTGVSGSYGMACSHIDEKQRVFGPSKFNVSASYFINPIGIHSMIISARELDKGTKMTLDS
MTASSIRAHLSSSTSSKPLVSFPLVQGMAYITAEYNGATPLLQTGVFFRNMTRSTQKPKK
DVTKHSFLLEDGTTWRVYGYKTKGDDLDLQVLNNGVATSAKPFYGIIQVVKESTTTNSDE
ESKLLDQGAGIYPVTMNLSGGVNGAAGNYQFNFEKSGHQDGELLMFALPHHVQSFDKPTL
GLRAKTVSLMTPTKGRAALVQGTKWNMVEPSMPVKLGFDPYDAQKGSMNKLSKSAKSTIK
AAASKELLQDMITATDLDSMYFSGKALAKYAFLLYVINDMLGETKLAQTGLGQLKAAFGR
FADNKQKYPLVYETAWGGVVSTGAYKTGQALEDFGNTYYNDHHFHYGYHILAAAVIGHLD
PSWIAKNKDYVNMLARDTSNPSGKDAIFPEWRSFDWYHGHSWATGLYASLDGKNQESSSE
DMMHAYGLKMWGQISRNAPLEARANLQLAITARSLQQYYLYEEDNTIQPAEFIGNKVAGI
LFENKIDHTTFFGNEIEYIQGIHMIPILPVSTVARRSKFVKEEWEAFFSNGRVDKIDNGW
KSLLLGNLATIEPKEAFEVLSGKTFDSRWLDGGVSLTWLLAYSAALGGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	318	1002	5.8e-216	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	290	1008	44	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	650	1000	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.73e-137	318	643	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY59065.1|GH81	0.0	1	1009	1	1009
UNI22551.1|GH81	0.0	293	1009	1	713
UKZ86758.1|GH81	0.0	298	1007	6	712
UKZ76665.1|GH81	0.0	298	1007	6	712
QLI67551.1|GH81	0.0	297	1006	5	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.20e-85	331	980	41	697	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	8.56e-85	331	980	66	722	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	8.78e-83	331	980	41	697	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	6.39e-23	681	993	361	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	6.78e-23	681	993	381	691	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.50e-212	297	1004	192	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	8.40e-177	301	1008	5	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.25e-150	291	1005	68	777	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	6.99e-148	309	1006	57	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.78e-141	309	1006	412	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.136068	0.863911	CS pos: 18-19. Pr: 0.7861

TMHMM  Annotations     

There is no transmembrane helices in ATY59065.1.