CAZyme Information: ATY58494.1

Basic Information

• Species: Cordyceps militaris
• Lineage: Ascomycota; Sordariomycetes; ; Cordycipitaceae; Cordyceps; Cordyceps militaris
• CAZyme ID: ATY58494.1
• CAZy Family: AA1
• CAZyme Description: cellulase (glycosyl hydrolase family 5)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	CP023322|CGC17	56048.75	7.7730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmilitarisATCC34164	9362	N/A	75	9287

• Gene Location: location=CP023322:4732571-4734088(+)

Full Sequence      

MAKKSRLGKGGSSPLHNPTTAPSTPSAPTAISSAAEESLRLLGPNESQAPASPPAIGIPS
PAASDDEDGAWDPDTPLPRWHSSTLKKRRRFTWCSMFLLLFLAAVVAGTLYIWRREAYLQ
SPWLPDDATNDFAQAPLPPPSERHSILQRKLPLRTRGRHIVDAAGDRFKLHSVNWYGASD
ELFVPGGLEVRHRTAIAQTIRRLGFNSVRLPYADELVLTNPVIAPHLVLANPDLAGLRAL
DVLEAVVAALTDAGLAVIVNNHITTATWCCGANPCDAGWANDHLGGLCAVRQTEEGWIRN
WETVMSRLRHDPLVIAVDLRNEVRGLWGTMPWATWAAAAERCGDRLLAMNPDWLVVVEGT
ESANDVSGARRRPVVLRRAPDKLVYSAHVYAWSGWGSWGGRFAQRGYASFVGTMRHNWLW
LLEQDVAPVWVGELGAARHTSRGGARYWRNLWRLLKDVDADFGYWAVNPTKAYQSTVETY
ALLEADWETPVLDYRMKDMVELMQR

Enzyme Prediction     

No EC number prediction in ATY58494.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	160	472	1e-147	0.9873015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.15e-24	161	469	1	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.39e-16	170	469	47	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
223021	PHA03247	7.76e-04	9	93	273	359	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY58494.1|GH5_24	0.0	1	505	1	505
UKZ59514.1|GH5_24	3.28e-204	79	505	84	505
UKZ85745.1|GH5_24	5.37e-203	94	505	95	505
UKZ55077.1|GH5_24	3.30e-202	75	505	72	497
QYT00999.1|GH5_24	2.43e-199	75	505	70	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	9.42e-39	155	489	8	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	2.49e-38	155	489	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
3AXX_A	2.76e-21	164	489	55	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3VVG_A	3.26e-21	164	489	22	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	6.66e-21	164	489	55	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	3.18e-36	155	489	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	7.75e-33	155	505	41	391	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|C0HLA0|GH5FP_CHAOB	6.00e-26	151	504	29	399	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	2.55e-24	153	489	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P10474|GUNB_CALSA	4.14e-20	153	435	630	936	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
91	113