CAZyme Information: ATEG_10289-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_10289-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	CH476610|CGC1	92757.76	6.9188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476610:194038-197070(-)

Full Sequence      

MDTNIASEIPLACSPGEGERCEHAKFSGDGLQTDAHVTEYGRLDIDIREDIPGTSELVEA
LENQPALEVSPPSDEKAPIHFPLRMNIVIHVVGSRGDVQPFIAIGQALQRHGHRVRLATH
LVFRDFVRQHGLEFFNIGGDPAQLMSFMVQNPKLIPKMDTLLHGAIGRRRKEIRTMIGGC
WRACLEAGEGIDLTSDAPLKADPFVADAIIANPPSFAHIHCAEKMGIPLHMMFTMPWSPT
QAFPHPLANIRASNVKPSAAKFASYAITEALIWQGLGDLQNDFRRFELGLETLDAMRAPS
IMHRLQIPFSYYWSPSLLPKPDDWKSHIDVCGFSFLPPDNKYKPSADLVRFLEVGPPPIY
IGFGSIVVDDPNALTKTVLDAVRLTGQRALISKGWGGLGADNLDAPDVFFLGNCPHDWLF
SRVSCVVHHGGAGTTATGLALGRPTTIVPFFGDQPFWGQLVALNKAGPSPIPYTKLTAER
LAEAIRFCLEPATIAQAEALSAKIRAEDGAQAGVESFHRHLKLRKLQCSLCPDRPAAWRV
RRTKVLLSPFAATVLVQENRLQPEDIKLYHPYHYDVNHDLRNPGCQGAEGIAGPLTSFLS
SIVEVPVNMVQNFAQPPSARFAEDFGLPSCDARASMITNSTDATSTTAVEEPANGSTTTS
ISDQSTIAASTTSSDSQDVPTMKNKHGFGSTVLANTSYTGRRFVNWIVQVPMGVTLGLSQ
GFHEAPRWYGDRMVREFPKVKGLRSGFVAAGKEFGYSLYDGVTGIVTQPRRGMDDAGVPG
LAKGIGKGVGGLLLKPQAGLWGLFGYPLNGIYRGIERSYGEDRQGSLWAVASSMAPYNTI
FEATAGSVYPHH

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	112	520	3.5e-62	0.9895287958115183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.30e-85	85	520	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.65e-42	84	519	1	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.93e-23	87	244	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.51e-06	355	522	224	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	2.39e-05	728	803	2326	2401	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46927.1|GT1	0.0	1	825	33	847
QMW34854.1|GT1	0.0	1	825	588	1402
UDD63884.1|GT1	0.0	1	825	33	847
QRD91178.1|GT1	0.0	1	825	15	833
BAE64641.1|GT1	0.0	41	825	41	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.27e-71	92	522	27	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.12e-71	92	522	47	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.14e-32	85	512	1	390	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.26e-26	85	507	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.91e-19	85	515	1	393	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.87e-130	84	521	155	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.10e-125	85	529	193	618	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	2.94e-75	52	521	1148	1609	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A2QNQ5|ATG26_ASPNC	3.74e-74	85	558	897	1345	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2
sp|Q6C8M8|ATG26_YARLI	4.52e-74	84	521	994	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ATEG_10289-t26_1-p1.