CAZyme Information: ATEG_10049-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_10049-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	CH476609|CGC8	59492.87	5.0612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476609:289793-291513(+)

Full Sequence      

MTPPATALVLALVGLGTGAAAVRDEPALLKRACPDYVSYASTPHAPYSGGPLNLPFQRPA
TECRTFSSPAVEQVIDDVTSRMVDKDLAQLFRNAFPNTLDTTVRWHTDGTSSSNQARQNR
RSTSQSQWNGPQTFVVTGDINAEWLRDSTNQLSGYQKLAQKDKKLYNLILGAINTQAEFV
IQSPYCNAFQPPPPSGLQPTNNGQDDKVHPAYEPSVVFECKYELDSLANFLALATEFHEH
TSATDFLTDRWYLALDTLLKVLDAQSQPTFNSDEQYAVNQYTFQRQTNLGTETLNLAGIG
NPLNKGTGLIRSAFRPSDDATILGFFIPPNAMMAVQLQKTARMLRTAGGAKNTQLADDLQ
RRGDALDRAVRDHGIVSHPKYGDVFAFEVDGYGSRILMDDANVPSLLSLPLLGYVAQDDP
VYLNTRKMVLDPDANPYYLTGSAFHGIGGPHIGLENAWPMSLLVQAMTSDSDAEIEECIN
LVRNSSLLGLVHESINVNNIKAYTRPWFAWANSVFAQTILKMAAERPHLVFGEGADPYII
Q

Enzyme Prediction     

No EC number prediction in ATEG_10049-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	84	520	2.9e-162	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	84	520	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	8.54e-147	63	529	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90853.1|GH125	0.0	1	541	1	537
QMW43832.1|GH125	0.0	1	541	1	537
QMW31801.1|GH125	0.0	1	541	1	537
UDD60757.1|GH125	0.0	1	541	1	537
BAE61251.1|GH125	0.0	1	541	1	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	3.47e-102	53	525	38	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.32e-100	53	525	18	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.05e-96	58	525	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.32e-72	71	526	12	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	7.17e-72	71	526	12	426	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.76e-186	31	530	25	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005020	0.994970	CS pos: 21-22. Pr: 0.5702

TMHMM  Annotations     

There is no transmembrane helices in ATEG_10049-t26_1-p1.