CAZyme Information: ATEG_09974-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_09974-t26_1-p1
• CAZy Family: GT33
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973	CH476609|CGC1	107110.50	4.6977

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476609:88864-91946(+)

Full Sequence      

MKPAILMKCWLFVSTVSASTLNGKLTLSETKVTGAVQLASTNSPPDIYIDPDDSVSVVRA
AQDLALDFGRVFGENATVRFTNETHPTSMAIIAGTIDKSAFLQRLIADHKLDVTSISGQW
ESYSSALVLGPAKGIQNALVIAGSDRRGAIYGLYDISEQIGVSPLFWWTDVTPTKLDAIY
ALDVQKVEGPPSVKYRGIFINDEAPALHNWILANYGQVENGDPAFISRFYAHVFELILRL
KGNYLWPAMWSNMFYVDDTNNGPLAEYYGVVMGTSHTEPMARATNEQSQFLNGTWDWISN
EDNVKAFMREGVIRSQHWETAYTMGMRGLGDAASPTLNATVEESIVSWQESVLSDILNTS
NLSNVVQPFVLFDELGTYYESDMTVPDQVTLIYPDDNAGNMLRLPLQNETGRSGGAGIYY
HFDMNAPPRCYKWINTAQLIRTWDQLRAAYSHGAQTVWVANIGDIKPLEIPMSFFFDMAY
DINGFSDPGSTYKWLEWWATKQFGANVASQTASIMTEYGQLIIRAKYEELSKTPYFFSVT
DYGEAQSNLQLWEDLEDRARAAYSQVRPDRQDAFFELILHPVLAGGNVERLYERLAENTL
SAKQLRASTNDRANEVLAAFQTDKDIETRWNNLQGGKWNHLMDQPHIGYTDWSDPPSNIV
PNVAFITGSTVDKSPCGVGVAVEGGAWTITNSSKVAAMPVNPYLPPSERRYLDLYATRNG
SFGYSVSSNVSYVKVSASTGRLSSPGTSDVRTNITVDWHNAPPGLTYAGLSVKCVGKEVQ
TLEVLLPVNRTAVPSGFKGFVESNGAVSIEAEHFTSATQSSSASYEVLPGYGRTLSGVTL
TPNTCPSQTIHDGPVLNYDLYTFTSSPNATVNLYLGPSLNINRLRPLLLAVSVDDSNPAM
LQPVADYVLGPPEGGENAIEGIWMRSVAVGPISPGRHTLRYWALEPGLIVEKLVLNLGGV
RQSFLGPPESLRL

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	34	673	6.8e-230	0.8622668579626973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	4.53e-178	189	528	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	1.78e-66	799	969	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAD34566.1|GH115	0.0	1	464	1	481
QMW46604.1|GH115	3.14e-306	33	973	27	965
QBZ60747.1|GH115	3.14e-306	37	973	33	967
QMW34550.1|GH115	8.91e-306	33	973	27	965
UDD63493.1|GH115	8.91e-306	33	973	27	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.87e-192	31	972	9	935	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.41e-139	38	970	46	849	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	1.11e-129	20	970	6	963	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PUG_A	1.15e-127	38	704	19	693	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.19e-127	38	704	18	692	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

ATEG_09974-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.073311	0.926665	CS pos: 18-19. Pr: 0.8774

TMHMM  Annotations     

There is no transmembrane helices in ATEG_09974-t26_1-p1.