CAZyme Information: ATEG_09890-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_09890-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	CH476608|CGC5	97615.71	5.7753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476608:1126405-1129098(-)

Full Sequence      

MQKLTQELSTGWVMKEHGGSTMSSWLPVKKVPSQVHIDLLANKKIPDPFVDANELEVQWI
AEKDWVYRTNFSTALSSEKVTTDLVFRGLDTFATVILNGTTILESENMHTSYRVDVSKFL
HSDQENELQIIFHSALLRGRELIQQHPEHTFHVRQTEASRIPVRKAQYNWGWDWGPILMT
AGPWRPVVLEQYIARIDDVWVEYEVSPGLQRVSGHLYAKLGKGLQEGDTVTLSLVGQDVE
AVKQTCRVGPDGLVKAAFQLDSPSLWYPLGYGQPSRYRLAAELLRKGARLDSQSKLVGFR
HCELVQEQDEFGKSFYFRVNSIDIFCGGSCWIPPDSFLAQMSRDRYFDWIKLLVESNQIM
IRVWGGGIYEDDAFLDACDEMGVLVWQDFAFACASYPVYPSFLASIEEEARQNIRRFRSH
PSVVIWAGNNEDYQVLERYKLEYDPEDNDPESWRKSTFPARYTYEYLLPKWIQEEDPSKI
YHPGSPWGDRKHSADPTVGDIHQWDIWHGQMRKYQDCADLAGRFISEFGMEAYPHLETIR
RVITDPAQQRPGSMMMDFRNKAIDHERRLMTYVAENFLVPSDLQAFTHVTHVLQAETMRY
AYKTWRRMWGRQGTRQCGGALVWQLNDCWPTMSWAIVDYYLVKKPAFYAIARALKPLDVG
IARDCPVWTTGHANPMATNSCNFDVWIASSLQEAVEIDVTVKFISIRSGKLIGETITTKR
LAEPNATTEVLKNEYARMCPPQHPGDYDPFIIYAVISTGGDVVATDIAWPQPLKYLDFSN
RNVKVQVSPSKDQITVSADLPVKGFVIEEHQGLKLSDNGFDLVPGEEHIVRVDQGSISNK
ELVWTYIGAHACQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	697	8.1e-90	0.6569148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.11e-77	45	659	47	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.65e-12	682	775	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	4.96e-08	194	300	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397119	Glyco_hydro_2_C	2.23e-05	374	433	64	137	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	3.45e-05	782	832	3	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96772.1|GH2	0.0	1	849	1	836
UKZ77816.1|GH2	0.0	1	849	1	878
UKZ51991.1|GH2	0.0	1	849	1	878
QYS99024.1|GH2	0.0	1	849	1	878
UKZ88363.1|GH2	0.0	1	849	1	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.91e-132	30	661	47	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	5.28e-132	8	841	11	825	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	5.55e-132	8	841	13	827	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	5.70e-132	8	841	13	827	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.49e-131	8	841	11	825	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CCA0|MANBB_ASPTN	5.22e-291	6	848	7	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1D911|MANBB_NEOFI	1.12e-290	1	848	1	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	4.52e-290	8	848	9	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	1.29e-289	1	848	1	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|Q5B7W2|MANBB_EMENI	1.70e-289	8	848	9	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_09890-t26_1-p1.