CAZyme Information: ATEG_09843-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_09843-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		33537.09	4.4201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476608:997264-998292(+)

Full Sequence      

MAPFSFILTVLLYALTCSARALGHAHALLPRAGSLEQVTDFGDNPTNVGMYIYVPNNLAS
SPGIVVAIHYSPEGTGTAEAYYTGSPYAQLAEQYGFIVIYPQSPYEGTCWDVSSQETLTH
NGGGNSNSIANMVTWAISKYNADSSKVFVTGSSSGAMMTHQNVMAATYPELFAAATVYSG
VPAGCFYSSSNQQDGWNSTCAQGQVITTPENWANVAKGMYPGYNGTRPKMQIYHGSVDTT
LLPQNYYETCKQWAGVFGYNYDSPQQVQDNTPQSNYATTTWGDDLQGIFATGVGHTVPIR
GDDDMAWFGFA

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	47	285	2e-16	0.920704845814978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.51e-34	50	258	1	199	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	5.20e-19	19	298	18	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	8.27e-19	52	245	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	5.35e-07	50	181	382	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	6.48e-06	52	180	178	302	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35424.1|CE1	1.94e-171	5	310	5	305
QMW47486.1|CE1	1.94e-171	5	310	5	305
QRD91842.1|CE1	1.94e-171	5	310	5	305
UDD64533.1|CE1	1.94e-171	5	310	5	305
BCS02633.1|CE1	2.47e-171	9	311	5	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	5.73e-171	32	311	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0C8Z1|AXE1_ASPTN	3.99e-236	1	311	1	311	Probable acetylxylan esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=axeA PE=3 SV=1
sp|A1CSZ8|AXE1_ASPCL	2.51e-172	1	311	1	307	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	3.44e-172	5	310	5	305	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	4.89e-172	5	310	5	305	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	4.89e-172	5	310	5	305	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999639	CS pos: 21-22. Pr: 0.9278

TMHMM  Annotations     

There is no transmembrane helices in ATEG_09843-t26_1-p1.