CAZyme Information: ATEG_09162-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_09162-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	CH476607|CGC12	66432.84	6.8089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476607:436875-438786(-)

Full Sequence      

MASLGEKIHARLSIFQDRGPDVPFFRQVLNLLGCLIILPMYYVMTAYTRHPLTLDILVTI
FAAELNRFCNERRRRRLYRLDGASSTTDAEKAMQAMVHSDLGPECMAAIVGFREDPELFA
RCLESYKSARECRFVLVGVDGDAAPDMEMIQVFQKVFPEDSAVIHLDEPLGEVAMRTFAK
VSESDGYAQPREVYMETAIAHCCELAREILIDHDLDIGEAGGVTRLCLYQPHLHKKGIMF
STFIFSIVLSEMLGVEYLWSSDSDTIVMDGSLRRTIETIAGDPHVGGGSAGLIVHNEHDS
ITTKLGSVVYWSELYLTRSVAMASGTSDCQSGPSTAFRVSVLPAVLYPWYTQTVLGHRMV
VNEDRHLTTNLLMRGWTVTYASDTLAATDTPTTLSRWIMQQVRWSRAGHIESFQQPKIYL
INNPLFFWAAVKREAGPLLGLLYIVYYLVTGNTFAYFSWYDAAFRTVYTIIYNYLRNPDR
KGKREAIWIIPALLFYNVPLPMVHLWSLITLFYDSWGTSMRSQSEITKRGEAWKRFKDLG
FMVVWAAIVGGSLARMFAFAAGWNTMAAIFWGMLIPGMVTFHGLVLRG

Enzyme Prediction     

No EC number prediction in ATEG_09162-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	3.89e-19	262	408	85	232	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	5.72e-18	262	571	145	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	2.57e-06	361	413	183	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
404520	Glyco_tranf_2_3	4.18e-06	257	407	90	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
133033	Chitin_synth_C	2.49e-05	262	404	81	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26501.1|GT2	1.49e-290	6	588	6	589
QRD87385.1|GT2	1.49e-290	6	588	6	589
QMW38580.1|GT2	1.49e-290	6	588	6	589
BAE55426.1|GT2	1.49e-290	6	588	6	589
UCK59072.1|GT2	1.49e-290	6	588	6	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	4.39e-26	109	407	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.87e-25	109	407	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O08650|HYAS3_MOUSE	8.31e-27	97	554	79	497	Hyaluronan synthase 3 OS=Mus musculus OX=10090 GN=Has3 PE=1 SV=2
sp|O35776|HYAS2_RAT	1.98e-26	105	407	88	357	Hyaluronan synthase 2 OS=Rattus norvegicus OX=10116 GN=Has2 PE=2 SV=1
sp|O00219|HYAS3_HUMAN	2.66e-26	105	554	90	496	Hyaluronan synthase 3 OS=Homo sapiens OX=9606 GN=HAS3 PE=1 SV=3
sp|P70312|HYAS2_MOUSE	4.75e-26	105	407	88	357	Hyaluronan synthase 2 OS=Mus musculus OX=10090 GN=Has2 PE=1 SV=4
sp|Q92819|HYAS2_HUMAN	6.36e-26	105	407	88	357	Hyaluronan synthase 2 OS=Homo sapiens OX=9606 GN=HAS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000010

TMHMM  Annotations     

Start	End
28	47
438	460
486	508
541	563
568	586