CAZyme Information: ATEG_09074-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_09074-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		63901.31	6.0328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476607:194371-196380(-)

Full Sequence      

MGSIEDMNTYDYIICGGGTSGCVVAGRLAENPDVKVLVIEAGQHNKDLENVHMTGGWSNN
FDSETDWNVVTKPMKGVNDRQVKLSRGRFLGGCSGCNGTLCIRGSKQDYNDWGLEGWSGD
EFFGAMMKAETFHPKDWFEADMKSHGFNGPLHTEPHDLAPIANLIMDSFVSQGLPLHHDM
FSTGDVPHGCGHVPRSVYKGIRTTSADFITNEYHRANVTIQTDTTVDRVLLEETSNGLRA
TGVVTQLPDGSSKTFYATKEVVVSGGAYCSPAILMRSGIGSREELAQFNIDCKVDLPGVG
KNLMDHLIVFMFYETEKEGLTNDWHVYHDDNLAKTYKQWKEQKSGFLSTFPFGCFAFARM
DERLKDEPMWRDAPRLPGRDPMGLTPAQPNVEFFTTECYGGPKQYNQFPIDHKHAFSMIA
ELFAPKSRGTVTLKSKDPKEIPVVDCNYLADPMDLLVLTEACRFGNEIIMKGAGTKDIVK
GSWPPNLTHHTYTTREEWIPYVKEHATTCYHAAGTCAMGKDDNPMAVLDNKLRVKGIQGL
RVADCSVMPTLHGGHTQMPAYGIGERCADFIKETW

Enzyme Prediction     

No EC number prediction in ATEG_09074-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	573	4.3e-163	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.18e-98	7	572	3	532	choline dehydrogenase; Validated
225186	BetA	9.66e-98	5	573	3	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.55e-38	425	567	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.52e-31	77	308	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.88e-18	8	547	54	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65288.1|AA3_2	0.0	1	575	1	574
QMW48130.1|AA3_2	0.0	1	575	1	574
QMW36070.1|AA3_2	0.0	1	575	1	574
QRD92967.1|AA3_2	0.0	1	575	1	583
AFB81353.1|AA3_2	0.0	1	575	1	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.85e-71	6	572	3	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.58e-71	6	572	3	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.60e-71	6	572	3	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	3.56e-63	10	575	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	6.33e-58	10	572	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.61e-72	10	572	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	8.29e-70	10	575	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	9.51e-68	9	574	6	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	1.66e-67	9	571	4	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	7.51e-66	10	571	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ATEG_09074-t26_1-p1.