CAZyme Information: ATEG_09048-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_09048-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	CH476607|CGC7	50488.30	4.3621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476607:124669-126258(+)

Full Sequence      

MRPSTPRLSSPFLLLLTLVAQLVHAIDISIDDEGTSLSPAESVKSAASEAVYGAMKWYSG
NDTGGIPGAFPDKWWEGSALFLSTLLYWHYTGDDTYNSVTSQGMEWQAGNGDYMPANYSS
YLGNDDQVFWGIAAMTAAEINFPDVPDKYSWLSLAQGVYNTQVARWDTSNCGGGLRWQIF
PYQAGYNMKNSISNGGLFQLAARLARYTNNQTYADWADKIWDWSASTPLLNNQTWNVADS
TDIETGCKTQGNNQWSYNYGTYLTGAAYMYNLTEKSYWKDRLDGLLGVTLDKFFPQKYGG
NVMSEILCEPQELCNNNEILFKGLVTSWLGFVAMIVPSTYDQILPKLQGSAQSAAQTCTG
MGNNSCGVRWYGNKWDGWHGMEEQISVADVISSAMLKFQAKAPLTSSTGGTSSSDPNAGG
TDSNSNSGNLKPITTGDKAGAGILTVVFVGLWGGMVAWLFIGG

Enzyme Prediction     

No EC number prediction in ATEG_09048-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	40	403	7.2e-101	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	42	387	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65580.1|GH76	4.47e-248	19	462	18	455
UDD65266.1|GH76	3.66e-247	19	462	18	455
QRD92992.1|GH76	2.28e-246	19	462	68	505
UDD65265.1|GH76	2.28e-246	19	462	68	505
QMW48108.1|AA3_2|GH76	8.12e-235	19	453	18	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.40e-96	41	419	34	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	8.51e-104	21	447	17	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.09e-100	15	447	3	432	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5ACZ2|DFG5_CANAL	8.00e-99	15	459	11	449	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	1.64e-98	14	459	7	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.43e-98	12	419	6	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999738	CS pos: 25-26. Pr: 0.9806

TMHMM  Annotations     

Start	End
439	461