CAZyme Information: ATEG_08874-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_08874-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	CH476606|CGC6	37648.70	6.6998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476606:1044436-1045513(-)

Full Sequence      

MGPSTARNGVLGCWHTIVFLILTTSVLLSLGQTIQAEPSTTHGPDGLQIRDGNRVALRIM
PLGASITAGYRSTDGNGYRKYLWEQLRYEGWEVDMVGSLRSGDMQDNENEGHYGYRVDQI
AEVVKKSYHFQPNLILIKYVHIYSSLPADALIVTVSSAGTNDALQNYNIDSVGDRMNGLL
TQLFDAIPGTTIILSTLLQNTRQPINVETVNREYRKLAAQRRADGDRVVLAEMSQFIKFD
QLKDGTHPIDLGYKEMASVWWAAIETAQQAGFLQKPNGVGSLTASNATSKQAVNANVSDP
DLPYYSAVPQPVSNRGLQAFREYWHVLLLVVALQLVIRHV

Enzyme Prediction     

No EC number prediction in ATEG_08874-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	57	264	8.3e-64	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	9.76e-39	57	264	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	7.80e-11	62	263	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.87e-09	62	254	2	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	1.76e-08	59	260	1	224	GDSL-like Lipase/Acylhydrolase.
405312	Lipase_GDSL_3	2.79e-06	144	257	56	170	GDSL-like Lipase/Acylhydrolase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30471.1|CE3	6.65e-85	17	321	22	314
CAP86338.1|CE3	1.95e-82	20	316	20	294
BAE62547.1|CE3	1.04e-80	17	279	15	261
EAA61410.1|CE3	4.58e-78	47	311	120	417
UDD56943.1|CE0	1.79e-74	17	280	15	262

PDB Hits     

ATEG_08874-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATEG_08874-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004340	0.995626	CS pos: 36-37. Pr: 0.9007

TMHMM  Annotations     

Start	End
12	34