CAZyme Information: ATEG_08405-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_08405-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		58623.78	5.1818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476605:1172210-1173811(+)

Full Sequence      

MHRFIALASVLTCGQAVVFSSVDIPLNSSGAILRQDAYGYSIEPSSLAPYLQSSLASKLL
NHIADIAGVPAPIRVGGNIADQTLFVPGLDVPSRAIPNDTTVDVLQIQKDWFRGWIEYFP
DGTDFIYCLNLRNTSESWTNAMQEAAAAMDVLGDSLSMFELGNEIDHYISKGWRNASWGT
KEYTRQWKQLTSQIMAADFYRQAEHQPLFQAAVFADPPWVPDQQDEIDDFDIINVTRAGL
VDPEIIKSYAVHLYPQSTCDAPRRARLSLDLLSDHQVVWRNLSQYVPQQAAAQAAGSPLV
LGETNSASCSGQSGISDTFGAALWATDYVLTAASIGIEKVYFHLGHHSEYSSFTPLPYEY
EGENLTAGIRANFYSHVFLAHVLASHDHTPRQITALPSANSSDFSGYAVFKEAARPELEK
LVFVDMGVWNSSMGLSNPSTVSATDSTFVSPGQRPRREVQVRTSWRAGTKVEIIRLQGPG
TNAKSEVNVSGVSFDPRSGERIGKSKPDRAVVRRNGVVEFELLQAEAVLLQRL

Enzyme Prediction     

No EC number prediction in ATEG_08405-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	39	370	1.9e-76	0.7098901098901099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	5.20e-18	406	529	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD59349.1|GH79	1.77e-278	7	532	5	533
BAE60286.1|GH79	2.38e-276	7	532	5	533
QMW30537.1|GH79	1.37e-275	7	532	5	533
QMW42595.1|GH79	1.37e-275	7	532	5	533
QRD89402.1|GH79	1.37e-275	7	532	5	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	2.03e-14	17	529	3	456	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	7.60e-12	8	357	12	341	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	7.85e-12	8	357	12	341	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	1.86e-11	8	357	32	361	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	1.01e-07	20	352	13	304	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	2.66e-24	5	495	8	507	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	1.40e-23	56	530	77	539	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000931	0.999053	CS pos: 20-21. Pr: 0.4325

TMHMM  Annotations     

There is no transmembrane helices in ATEG_08405-t26_1-p1.