CAZyme Information: ATEG_08226-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_08226-t26_1-p1
• CAZy Family: GH92
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		48746.28	8.8197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476605:692964-694296(+)

Full Sequence      

MNARRIRYRIFPCRLNRRWSILALVLIVYFLICHLPGPPATQNNTRADRPPPKHRVDEQP
HFLYRSPFRQNPDLEYEKRLSDDLQKLEQEALTRHGRSNIAENRIWQIAQDEDHRGSDSI
SFEKRNTDWMYTLVTDAKALEFVTNELSAIPDIASVYKSYPHNVLRADLLRYLLLWYYGG
FYADTDVFAAKPIKKCRALQPVFAATSDGDRRESVSPEVSLVVGVEVDEPYATRQFMHDW
HWTRSYGFIQYTMYAPRRFSPLLRETIVRALSHTRQHDAKYFGLFRSWRYNEKAILGVTG
PDVFTDTILDTLSSSLPPTHPLVQDSVSAEAEVRDLVSRETGKTQKRVTWAPFHRLHDTI
CIDAGEAMPTAPMGGLCVLPISAWGNGQRHSQAEGFNSPQACINHRFGRTWKKGWWEYIF
G

Enzyme Prediction     

No EC number prediction in ATEG_08226-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	122	196	2.4e-19	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	5.69e-04	121	193	10	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	6.45e-04	60	193	35	174	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98643.1|GT32	9.23e-212	4	421	5	421
QQK43033.1|GT32	1.18e-203	27	421	3	395
BCS21634.1|GT32	2.29e-160	10	421	10	414
QKX54668.1|GT32	1.12e-155	17	421	14	403
QMW25899.1|GT32	1.38e-151	48	421	47	413

PDB Hits     

ATEG_08226-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.45e-19	104	412	105	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	4.99e-19	104	413	102	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.35e-12	105	412	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|O14084|IMT1_SCHPO	1.73e-07	105	193	68	159	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	2.70e-07	128	187	87	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000004

TMHMM  Annotations     

Start	End
21	38