CAZyme Information: ATEG_08151-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_08151-t26_1-p1
• CAZy Family: GH7|CBM1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	CH476605|CGC14	34072.06	5.0063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476605:483077-484112(+)

Full Sequence      

MSTPRILFNSGIGPAEQIKNVQSGSTGITVPPQAEWISLPVGQNLKDHPMFTITVNTGSN
FTAYNTSSVMSVPSARDRRLFAQGSGVLTQGGHRLQFWTSNVGSDGVTRFYQGSCSPSAD
GGITMKLYLTHGATSSGVLGINDAGSTTLVSDPWLQTTEDKDAVTKFLDNLLSDLSKSFS
VKGVSTASDILNDMTSGDHWVGTAKMGLDDGRENGTSVVDTNTKVYGTENLYIVDASIHP
DLPTGNTQAIVMVAAEAAVARILAQDNTQGSASTSVSSMAAIPSSTASAVITGGSIGESA
ATPSLVVVTTTKTVMVTQTHTVTVMPTL

Enzyme Prediction     

No EC number prediction in ATEG_08151-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	265	3.2e-89	0.5109489051094891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398739	GMC_oxred_C	1.52e-15	190	248	79	133	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	1.91e-14	3	248	267	519	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.37e-13	3	244	256	468	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	3.26e-10	199	247	473	516	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83935.1|AA3_1|AA8	3.38e-130	1	288	492	785
QMW44486.1|AA3_1|AA8	3.38e-130	1	288	492	785
QMW32457.1|AA3_1|AA8	3.38e-130	1	288	492	785
UDD57457.1|AA3_1|AA8	3.38e-130	1	288	492	785
GAA91858.1|AA3_1|AA8	1.21e-127	1	272	498	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	5.51e-47	5	265	487	766	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1NAA_A	3.88e-42	3	264	257	536	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	4.14e-42	3	264	262	541	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	2.17e-39	5	264	265	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	7.16e-39	5	264	487	766	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.27e-40	3	264	489	768	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|A8JHB7|FAP_CHLRE	1.32e-08	3	265	306	599	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|Q5UQH8|YR833_MIMIV	1.05e-06	195	253	21	71	Putative truncated GMC-type inactive oxidoreductase R833 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R833 PE=3 SV=1
sp|Q9VY01|EO_DROME	2.34e-06	1	263	338	644	Ecdysone oxidase OS=Drosophila melanogaster OX=7227 GN=Eo PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999882	0.000127

TMHMM  Annotations     

There is no transmembrane helices in ATEG_08151-t26_1-p1.