CAZyme Information: ATEG_07935-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07935-t26_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	CH476604|CGC9	80061.60	6.1066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1427900-1430029(+)

Full Sequence      

MSKTIELQSKALRVTVLVDQDGTVFLQEVAPPDSVPKKSTSKYFSDSYTPLVEVRLAGEG
TAKHKSSKTLLGGYIGTRLKYKSHHIRVGEASQTLDVNLVDDVIHIIVTAHLTVYDSIPV
LRATATAQNNGAEPVVLTQVTSLVLGGLTLGSEKWWSDYTLSVPNNSWFREAQWIEHDLP
SLGIDDYGVYGRPENHWGTLAHYAVSNKGSFSTEGHLPMGLLKRRDNSESWLWQVENNGS
WRWEIGDWKDSVYLAAGGPVEVDHDWRERLRPGESFTTVPVALCHVMQSYDAAFAAMTEY
RRQIRWKHPDHERLPIIFNDYMNCLMGDPTDEKILALIDPVVQAGAEYFVIDAGWYADDS
GWWDDVGLWEPSKKRFPMGFKQLLSTLKERGLTPGLWIEPEVIGVRSIVSTQLPNEAFFQ
RDGQRIVEKGRYQLDYRHSAVRERMHEIIRRLVEDYGVGYFKFDYNIEVTQGTDVDCFGP
GMGQLGHNRAYLSWVTELHKKYPGLVIENCSSGAQRMDYAMLAVHALQSTSDQQDPDRYA
AIAAALPTAVTPEQAATWAYPQPDWDDETNAMTVVNSLLGRIHLSGRLDLLQPHQFELIR
HGMDVYRSIRTDFRMAVAFWPLGLPQWHDDWVALGLTVQGKGRHYVAVWRRGGPDSMELK
IPSCPSQTARSELLYPVGFPGEAVWAASEGKLTIWLPSNLSARLFRLTV

Enzyme Prediction     

No EC number prediction in ATEG_07935-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	50	654	5e-94	0.8575581395348837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	6.95e-81	313	607	1	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	4.10e-29	275	536	1	264	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	1.86e-21	77	535	82	508	Alpha-galactosidase [Carbohydrate transport and metabolism].
407116	Glyco_hydro_36N	5.17e-07	73	145	68	154	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
269893	GH27	8.92e-07	318	396	5	84	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46905.1|GH36	0.0	1	708	60	772
BAE64621.1|GH36	0.0	1	708	3	715
QRD91154.1|GH36	0.0	1	708	60	772
QMW34832.1|GH36	0.0	1	708	60	772
UDD63863.1|GH36	0.0	1	708	3	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.19e-27	33	518	74	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	2.08e-27	33	518	74	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNR_A	1.49e-26	70	535	93	551	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	8.04e-26	70	535	93	551	Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNQ_A	1.07e-25	33	535	70	551	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	6.10e-27	33	518	74	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|Q9ALJ4|AGAA_GEOSE	7.65e-26	70	535	93	551	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
sp|P43469|AGAL2_PEDPE	3.61e-23	265	613	279	626	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
sp|P43467|AGAL1_PEDPE	3.71e-23	92	521	132	539	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|P27756|AGAL_STRMU	9.39e-17	63	535	99	544	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07935-t26_1-p1.