CAZyme Information: ATEG_07926-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07926-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: chitin synthase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896	CH476604|CGC16	101241.60	8.1582

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1405462-1408572(-)

Full Sequence      

MSNPRRPYSLHSAQQSRSSNYSHTSPSRTQTPGHSDRDDQEQSLLHRSMASPYGTPYEDP
SVSTDSLRRYTLHDPGVTVFAAPPYQESESADVYDAHMSDKDAINLNTWQQPSVSGRSGG
LRRYGTRKINLVQGSVLSVDYPVPSAIQNAIQPEYREAEEAFPEEFTHMRYTAATCDPDE
FTLRNGYNLRPAIYNRHTELLIAITYYNEDKVLTARTLHGVMQNVRDIVNLKKSEFWNKG
GPAWQKIVVCLVFDGIEPCDKNTLDVLATIGIYQDGVMKKDVDGRETVAHIFEYTTQLSV
TANQQLIRPHGNDSSNLPPVQMIFCLKQKNSKKINSHRWLFNAFSRILNPEVCILIDAGT
KPGRKSLLALWEAFYNDKTLGGACGEIHAMLGAGWRKVLNPLVAMQNFEYKISNILDKPL
ESAFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSKRLGKKGIEGMNIFKKNMFLAE
DRILCFELVAKAGFKWHLTYVKASKAETDVPEGAPEYISQRRRWLNGSFAAGLYAMMHFG
RIYRSGHNIVRLFFLHIQMIYNFCQLIMTWFSLASYWLTSSVIIDLVGTPSETNKNIGWP
FGNEATPIVNNFIKYGYLFCLMLQFILALGNKPKATRLPYTLSFLYFSLVQIYVLVLSFY
LVANAFTGGMLDFNFDNGVGAFLSSFFSSSGGGIVLIALVSTYGIYAVASLLYMDPWHIL
TSSWAYFFGLTTSINILMVYAFCNWHDVSWGTKGSDKAENLPSAQTKKSDDNKQQNFIEE
IDKPQADIDSQFEATVKRALAPWVEPEEDSGTSLDDGYRNFRTVLVLLWVFSNLIVSLLI
TSTGVDRMCLTNTSTTRTSWYFQVILWATAGLSIFRFLGSLWFLGKSGILCCVNRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	206	374	8.8e-72	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	5.43e-99	206	374	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.34e-90	202	531	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	2.73e-28	128	205	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.51e-26	323	680	115	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	9.05e-18	322	443	55	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60315.1|GT2	0.0	4	896	3	893
BAB85683.1|GT2	0.0	4	896	3	893
QRD89452.1|GT2	0.0	4	896	3	893
UDD59386.1|GT2	0.0	4	896	3	893
QMW30573.1|GT2	0.0	4	896	3	918

PDB Hits     

ATEG_07926-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	6	896	5	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	32	852	23	864	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P54267|CHSG_ASPFU	0.0	28	896	20	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|Q00757|CHSB_EMENI	0.0	57	896	85	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P29070|CHS1_NEUCR	0.0	110	896	130	917	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

Start	End
524	543
552	574
608	630
642	664
691	713
720	742
823	845
858	880