CAZyme Information: ATEG_07909-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07909-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		40631.49	6.8737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1361523-1362638(-)

Full Sequence      

MPNFGQKILKHLGLEEGHASGFPGHGQGQGHGQPDAARLPGNRVINNDERSLSNRPGGTY
PRICRMGDGSVLSSFTRFNHGERILTVARSVDGARTFEDIGEVTRGRGDVDNLFLLEVAP
NVVLGAFRNHDLGPGGPTHFRITVCRSVDGGRSWQFASQAAESKPPCGIWEPFMRLGQRG
EVQLTYSQEYAHNNQCTMLVRSWDQGATWSPPECLHGREHCVRDGMNGIAQTWDNGRPAL
VMVFETTTHGTFDLEALISYDDGATWGHRHEVYVPPRGHNAGAPQIAAFGDGSLAVIFMT
DEDHHQVEWTKNACIKVVFAGPPQDGRIFWTRPTVLCPGQGHWPGIAALDQRTLLATYDC
GGPKAKSITLH

Enzyme Prediction     

No EC number prediction in ATEG_07909-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	56	313	1.5e-66	0.8990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.15e-07	118	307	21	225	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.04e-06	133	304	165	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24955.1|GH93	1.48e-193	1	371	1	365
EAA62412.1|GH93	3.37e-188	1	370	1	366
BCR99274.1|GH93	6.86e-188	1	370	1	375
BCS11580.1|GH93	6.86e-188	1	370	1	375
QMW42642.1|GH93	7.37e-188	1	371	1	379

PDB Hits     

ATEG_07909-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATEG_07909-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07909-t26_1-p1.