CAZyme Information: ATEG_07907-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07907-t26_1-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		26367.66	9.8266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1357249-1358116(+)

Full Sequence      

MSAVPPPQVRETINLLISNLVNIKDETGKFLLRLQDGRVIDTKSWHGWEWTHGIGLYGIW
KYYEMTGDAKLLQIIEDWFAARFAEGGTTKNINTMAVFLTLAYVYEKTGNVTYLPWLDAW
AEWAMHDLPRTRFGGMQHITYLTENYQQLWDDTLMMTVLPLAKIGKLLNRPAYIAEAKRQ
FLVHIKYLFDARTGLFYHGTAPGRGILFSIIRTRTWKPLRRPGLPMAS

Enzyme Prediction     

No EC number prediction in ATEG_07907-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	200	3.6e-52	0.4819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.69e-59	19	199	7	182	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.53e-53	22	199	1	176	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46699.1|GH105	1.69e-131	6	199	7	200
QMW34630.1|GH105	1.69e-131	6	199	7	200
QRD93550.1|GH105	1.69e-131	6	199	7	200
BAE56723.1|GH105	1.69e-131	6	199	7	200
UDD63587.1|GH105	1.69e-131	6	199	7	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	4.05e-103	8	199	7	198	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	8.16e-92	8	199	25	216	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.39e-91	8	199	26	217	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	3.08e-06	48	198	23	176	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	5.30e-22	48	198	29	181	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07907-t26_1-p1.