CAZyme Information: ATEG_07905-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07905-t26_1-p1
• CAZy Family: GH71|CBM24
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	CH476604|CGC1	60328.82	6.8524

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1352777-1354590(+)

Full Sequence      

MGPTGTNWDFIVVGGGPAGCALASTLARSAKRPQVLLLEAGCRNEDKNLRVDGQRWTTFM
NGDMNWGYKTTPQEHCNGRQIDYSRGKVLGGSSAINFGVYTVGARDDYDEWASLVGDESF
SWNSMQKRFKRLETFHGTIADEKNAKYAGPKSSDHGSGGDLRVGYAAEWEQDLPLMMDVF
EQAGLARNPDHNSGDPLGMALVINSSHQGQRVTATDLLRNSPDNLSIITETPVRRLILDG
LKAIGVETAGSQYPDALWHRSPRPSSRNFRSPSSRIFLRSARVFAITSSLLSASSATRRR
TTATASSVTGGDGCGPWSCGKKTALGRGAKHSCQIAAGWFKSDRLTASPEFQALPAATQE
FLQRATIPHYEFMTHFPIHLIMPEVTKDYSYVCLLVFLMNEQSSGEVRLQSANPDDPLLF
DPKFLSHPFDRRACIETFREALQVTKHEAFTKDTVSTLIAPASESDEDILEFWKNTLGSS
WHMTGTVKMGKVGDSQAAVDSKFRVFGVENLRVADMSVVPVLTNNHTQATAYMTGLSCAD
GLIAEYGLDVA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	249	3.2e-67	0.43485915492957744
AA3	334	543	6.5e-49	0.3714788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.36e-63	1	545	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.63e-53	9	540	7	529	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.68e-37	402	536	2	141	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.37e-15	8	535	56	569	Protein HOTHEAD
366272	GMC_oxred_N	1.14e-12	76	248	14	167	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46531.1|AA3_2	4.22e-281	1	551	1	568
BCR99292.1|AA3_2	1.88e-277	1	551	1	568
BCS11595.1|AA3_2	1.88e-277	1	551	1	568
BCS19530.1|AA3_2	1.21e-212	8	551	8	569
QMW33321.1|AA3_2	1.84e-210	9	548	6	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	3.13e-40	3	545	36	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	3.21e-31	7	545	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	5.79e-31	7	545	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6YS1_AAA	6.37e-31	5	533	5	551	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	6.37e-31	3	533	3	551	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3L245|PDH1_LEUMG	1.61e-39	3	545	36	599	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.86e-38	7	540	40	605	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|V5NDL4|PDH1_AGACM	8.40e-38	3	532	32	580	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	2.61e-37	6	540	3	525	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	6.50e-36	3	545	36	597	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000108

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07905-t26_1-p1.