CAZyme Information: ATEG_07855-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07855-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		64842.97	4.7550

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1198980-1201169(-)

Full Sequence      

MWPRLDLKCGSQPQALCWLVSMLHAFVRETPPFSGVNSTANHSAWSPPRVQYGTPGVKAS
FDYIVVGGGTAGVTLAARLAEANYSVALVEAGDYYEIKFPLMKIPVATAIGVGSDPDAKT
PVDWGFIAKGVPGVNHRDIHFARGKCLGGSPNVGAMQRWADLVDDQSYVFDQVLPFFKRT
IQFTPPNESLRDENATAEYDADAFEDDAGPVQVSYPNSASSFATWLSLAFESKGFKEAQG
FSHGSILGSQFTPFTIGPSHQTRSGSDSFLWNSWTPFLSLYKNTMAKRILFSPQKQAIAV
DVQTLLTEYTLAVNKEVILSAGAFQSPQLLMVSGIGPESTLDEYEIEVIVDHPGVGQNLT
DHVFFGPTHQVLLETHTRLATDLKYLLREAFKYVTSHTGAFTNAGADYLAFEKLPESARK
TLSNRTKSDLAWLTSDWPEVEYFSADVYLGNFSNPILSQPRDGNQYASIAVVLAAPTSRG
NITIRSTDTADLPEINLNWLDTETDQEVAVAAFKRARDVFQSEAMRPVLVGDEFFPGSEY
QTDEEILDIIRNAAMTLYHPACTCRMGTEDDPMAVAVWKVNVAAFGLRKTG

Enzyme Prediction     

No EC number prediction in ATEG_07855-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	60	575	4.2e-136	0.9137323943661971

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.03e-74	60	575	5	487	choline dehydrogenase; Validated
225186	BetA	1.72e-66	57	577	4	490	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.39e-22	476	575	1	104	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.74e-18	43	557	38	498	Protein HOTHEAD
366272	GMC_oxred_N	6.86e-12	134	362	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89774.1|AA3_2	1.09e-211	53	589	43	592
QMW30869.1|AA3_2	1.09e-211	53	589	43	592
QMW42920.1|AA3_2	1.09e-211	53	589	43	592
UDD59712.1|AA3_2	1.09e-211	53	589	43	592
BCS02136.1|AA3_2	1.97e-205	51	575	30	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	4.00e-38	61	575	41	553	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	1.04e-34	59	575	1	518	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	3.45e-34	61	575	2	517	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZE2_A	2.71e-33	57	588	2	552	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3NNE_A	5.74e-30	61	574	14	481	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.78e-144	51	582	42	587	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	2.24e-142	60	582	51	587	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.27e-127	29	575	20	563	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.24e-124	46	575	21	563	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|C8VDT4|STCN_EMENI	1.48e-120	40	588	55	605	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999377	0.000643

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07855-t26_1-p1.