CAZyme Information: ATEG_07810-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07810-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: cutinase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216	CH476604|CGC3	22679.86	5.0028

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1065069-1065861(+)

Full Sequence      

MNYKLLTLALASLAAANPIERQRKIHPAVLSGGDELRNGDCQPVTFIFARASTEQGLLGG
STGPALCNRLKSALDGVACQGVGPKYQATLAANALPKGTSDEAIEEAQSLFQLAAEKCPD
TQIVAGGYSQGTAVMHGAIPGLDDALKDKIKGVVLFGDTRNQQDNGQIPDFPKDKIKIYC
AAGDMVCYGTLIVAAPHFSYIADVPDAADFLVSKLE

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	41	215	1.9e-42	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.00e-62	41	215	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91580.1|CE5	5.11e-113	1	216	1	212
EAA62121.1|CE5|3.1.1.74	5.57e-97	1	215	1	218
BCS30115.1|CE5	3.64e-95	1	215	1	213
QMW26781.1|CE5	1.96e-94	1	215	1	212
BAE55151.1|CE5|3.1.1.74	1.96e-94	1	215	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	1.76e-92	30	215	10	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	7.21e-92	30	215	1	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	6.93e-76	32	215	14	198	Chain A, cutinase [Malbranchea cinnamomea]
1CUY_A	2.13e-58	34	215	21	207	Chain A, CUTINASE [Fusarium vanettenii]
1AGY_A	5.55e-58	34	215	7	193	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CES4|CUTI2_ASPTN	5.24e-155	1	216	1	216	Probable cutinase 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_07810 PE=3 SV=1
sp|B6H2E9|CUTI2_PENRW	9.08e-114	1	216	1	212	Probable cutinase 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=Pc13g05110 PE=3 SV=1
sp|P52956|CUTI1_ASPOR	3.48e-95	1	215	1	212	Cutinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cutL PE=1 SV=1
sp|B8MVS3|CUTI1_ASPFN	3.48e-95	1	215	1	212	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_072700 PE=3 SV=1
sp|Q5AVY9|CUTI2_EMENI	7.13e-95	1	215	1	216	Cutinase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000312	0.999658	CS pos: 16-17. Pr: 0.8873

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07810-t26_1-p1.