CAZyme Information: ATEG_07790-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07790-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	CH476604|CGC2	36794.81	5.5835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:1007914-1008996(-)

Full Sequence      

MKTSFGLLALAAAAKLVNAHATVFAVWINDEDQGLGNTADGYIRSPPNNSPVTDVTSKDM
TCNVNGATAAAKTLDVKAGDKITFEWHHNSRDASDDIIASSHLGPVMVYMAPTEKGSAGS
GWVKIAEDGYSNGKWAVDTLIANRGKHSITVPDVPAGEYLFRPEIIALHEGNREGGAQLY
MECVQVKVTSDGSKTLPEGVSIPGTYTATDPGILFDIYNSFDSYPIPGPAVWDGSSSGSS
SGSSKTTAAAPAATSAASASSTKAPATTAAPVQTESAKPATSTTQAAAPTTLVTSAKPTA
TATAGAGDSGSGSCSATAPATGVVKMYAQCGGMNYSGSTTCESGLTCKQWNPYYHQCVKA

Enzyme Prediction     

EC	1.14.99.56:2	1.14.99.56:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	8	219	6.2e-68	0.9863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	4.62e-93	20	232	1	216	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	3.85e-79	22	224	2	211	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
197593	fCBD	1.42e-12	327	358	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.98e-12	326	354	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE55582.1|AA9|CBM1	1.44e-153	1	360	1	367
QRD87581.1|AA9|CBM1	1.44e-153	1	360	1	367
QMW26328.1|AA9|CBM1	1.44e-153	1	360	1	367
UCK58873.1|AA9|CBM1	1.44e-153	1	360	1	367
ABF50850.1|AA9|CBM1|1.14.99.56	4.12e-153	8	360	7	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ACF_A	3.61e-69	23	238	4	224	Chain A, LYTIC POLYSACCHARIDE MONOOXYGENASE [Panus similis],5ACG_A Chain A, LYTIC POLYSACCHARIDE MONOOXYGENASE [Panus similis],5ACH_A Chain A, LYTIC POLYSACCHARIDE MONOOXYGENASE [Panus similis],5ACI_A Chain A, LYTIC POLYSACCHARIDE MONOOXYGENASE [Panus similis],5ACJ_A Chain A, LYTIC POLYSACCHARIDE MONOOXYGENASE [Panus similis],5N04_A Chain A, Auxiliary activity 9 [Panus similis],5N05_A Chain A, Auxiliary activity 9 [Panus similis],5NKW_A Chain A, Auxiliary activity 9 [Panus similis],5NLN_A Chain A, Auxiliary activity 9 [Panus similis],5NLO_A Chain A, Auxiliary activity 9 [Panus similis],5NLP_A Chain A, Auxiliary activity 9 [Panus similis],5NLQ_A Chain A, Auxiliary activity 9 [Panus similis],5NLR_A Chain A, Auxiliary activity 9 [Panus similis],5NLS_A Chain A, Auxiliary activity 9 [Panus similis],6YDG_A Chain A, Auxiliary activity 9 [Panus similis],7NIM_A Chain A, Auxiliary activity 9 [Panus similis],7NIN_A Chain A, Auxiliary activity 9 [Panus similis]
5NLT_A	1.02e-54	23	238	4	228	Chain A, CvAA9A [Achaetomiella virescens],5NLT_B Chain B, CvAA9A [Achaetomiella virescens],5NLT_C Chain C, CvAA9A [Achaetomiella virescens],5NLT_D Chain D, CvAA9A [Achaetomiella virescens],5NLT_E Chain E, CvAA9A [Achaetomiella virescens],5NLT_F Chain F, CvAA9A [Achaetomiella virescens],6YDC_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDC_B Chain B, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDC_C Chain C, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDC_D Chain D, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDD_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDD_B Chain B, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDE_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDF_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDF_B Chain B, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens]
4D7U_A	8.71e-49	20	232	1	225	The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A],4D7U_B The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A],4D7V_A The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A],4D7V_B The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A]
5FOH_A	2.00e-45	26	219	3	205	Crystal structure of the catalytic domain of NcLPMO9A [Neurospora crassa OR74A]
5TKF_A	6.54e-43	20	232	1	221	Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_B Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_C Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_D Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKG_A Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKG_B Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKH_A Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKH_B Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKI_B Neurospora crassa polysaccharide monooxygenase 2 resting state joint X-ray/neutron refinement [Neurospora crassa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CEU4|EGLD_ASPTN	1.11e-228	1	360	1	360	Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglD PE=3 SV=1
sp|B0Y9G4|EGLD_ASPFC	1.49e-170	1	360	1	349	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglD PE=3 SV=1
sp|A1DBS6|EGLD_NEOFI	2.89e-170	1	360	1	348	Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglD PE=3 SV=1
sp|Q4WBU0|EGLD_ASPFU	6.04e-170	1	360	1	349	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglD PE=3 SV=1
sp|A1C4H2|EGLD_ASPCL	5.81e-157	1	360	1	353	Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999764	CS pos: 19-20. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07790-t26_1-p1.