CAZyme Information: ATEG_07719-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07719-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	CH476604|CGC7	48052.68	4.0240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:812560-813939(+)

Full Sequence      

MLSGWIVFNTALGCSDSDSNDCITRTMTSVTTYETTLPQPTTTTPQPPGCTDSAVACPSA
DSCPGWTDWKTYKAKNGVNLGGWLELERVFYPEWWDSVAPDAADEWTLCESLGAECSRVL
ENHYATYITTSDIDKVAAVGVEILRIPVTYAAFIEVPGSQLYHGSQLAYLREITEYAISE
YNMRIILGLHSLPGGVNMLDIGEALGHDDWFYNQTNLDYSYQAVEAVLDWISDASKPEAF
TFSPINEASDNIAGFGTPDTLTNNGTVWVVEYVRGTIDRVKKKLPCLPIMMQDCFMGEEH
WSPYFGECDNVAMDVHIYYFAAAGIYSQYVPVAICGQAEGTVGDGKLPVFVGEWALQVLY
NNSFAMREEIFNTQRYAWYKYLHGGTFWSIKHNSIAPVDGEGLQRDYWSYEGLIDEGVIT
PWDDNEVYCE

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	124	401	1.1e-116	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.08e-05	104	318	49	254	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56129.1|GH5_23	6.46e-157	66	429	101	463
CCD33736.1|GH5_23	6.46e-157	66	429	101	463
QKD53692.1|GH5_23	2.64e-142	1	420	6	429
QGI92196.1|GH5_23	7.50e-142	68	420	73	429
QGI78478.1|GH5_23	7.50e-142	68	420	73	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	7.58e-127	64	419	9	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	3.51e-119	66	420	14	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	2.05e-13	77	330	11	261	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	3.76e-13	77	330	17	267	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	4.89e-13	77	330	11	261	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	9.08e-29	72	354	37	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	5.73e-25	77	355	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	5.73e-25	77	355	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	1.11e-23	77	354	31	297	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q0CR35|EXGA_ASPTN	1.70e-23	68	354	34	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.908208	0.091797

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07719-t26_1-p1.