CAZyme Information: ATEG_07446-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07446-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
906	CH476604|CGC12	98466.63	6.0461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476604:115068-117942(-)

Full Sequence      

MAGFYFFWSYHSASEGEFDFTTGAHNLQRLFDYAKQAGLYVIARAGPYCNAETSAGGFAL
WAANGQMGRERTSDAAYHARWQAWIAAVGEIIAANQITHGGPVILNQHENELQETVYAAD
DTRVQYMEQIAAAFDAAGIVVPSSHNEKGMRAVSWSTDYHDVGGAVNVYGLDSYPGGLSC
TNRDAGFRLVRTYYQWFQNYSFTQPEYLPEFEGGWFQPWGGAVYDTCAAELSPEFADVYY
KNNIGSRVTLQNLYMVFGGTNWGHSAAPVVYTSYDYGAPLRETREVRDKLKQTKLLGLFT
RVSGDLLKTYMEGNGTGYTSDAAVFTWALRNPDTHAGFYVVAHESSPSRAVTDFALNVNT
SAGAMTIPDIQLDGRQSKIVVTDYSAGRASLLYSSAEVLTYTTLDTDVLVFYLNVGQTGT
FAFKHAPRGLRFQVYGESKLRAANTTHGTQYSYVQAEGVTAVKFSNGVVVYLLDKASAWN
FFAPPLTSTPEVAPDQHIFVLGPYLVRGASIKGTTVEITGDNANTTSLEVYAGDDKVTKV
KWNGKPVKTKRTAYGSLIGTAPGAEDVKITLPSLGPWKAQDTLPEIDPAYDDSRWTVCNK
TTSVNAQKPLSLPVLYSGDYGYHTGTKIYRGRFDGQNATAANVTVQNGVAAGWAAWLNGA
YVGGAVGSPSQVTTSAVLTFNQSTLRARDNVLTVVTDYTGHDQNSQGPLGTQNPRGILGA
TLAGGATFTSWRIQGNAGGERNIDAVRGPMNEGGLYGERMGWHLPGYEAAAAAAASSPLD
GVSGAEGRFYTTRFRLDLPADMDVPIGLQLGAPAGTAAVVQVFMNGYQFGHYLPHIGPQT
LFPFPPGVINNRGENTLAISLWALTDAGARLDRVELKTYGQYRSGFDFNRDWSYLQPRWT
DRAEYA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	4	296	2.6e-67	0.8534201954397395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402180	BetaGal_dom2	1.13e-72	306	480	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
396048	Glyco_hydro_35	4.94e-64	4	297	43	315	Glycosyl hydrolases family 35.
198097	BetaGal_dom2	1.20e-56	305	481	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	2.22e-34	756	867	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	2.25e-26	590	702	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57280.1|GH35	0.0	5	906	82	984
QMW27553.1|GH35	0.0	5	906	82	984
QRD81954.1|GH35	0.0	5	906	82	984
QMW39624.1|GH35	0.0	5	906	82	984
UDD55445.1|GH35	0.0	5	906	82	984

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.51e-164	4	876	55	943	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	5.76e-160	4	876	95	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.59e-159	4	876	95	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
3OG2_A	1.43e-157	4	885	75	984	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	5.06e-149	4	876	95	977	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6QHA9|BGALC_TALMQ	0.0	5	906	80	999	Probable beta-galactosidase C OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacC PE=3 SV=1
sp|A7EZS5|BGALC_SCLS1	0.0	5	906	78	984	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1
sp|B0Y752|BGALC_ASPFC	0.0	5	906	82	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1
sp|B8N2I5|BGALC_ASPFN	0.0	5	906	82	984	Probable beta-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacC PE=3 SV=1
sp|A1CE56|BGALC_ASPCL	0.0	5	906	82	985	Probable beta-galactosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996303	0.003746

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07446-t26_1-p1.