CAZyme Information: ATEG_07158-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_07158-t26_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		51044.76	4.6969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476603:878064-879727(-)

Full Sequence      

MKLKFSIHNSPVSFWSSIICMTTLSFQLAHASISLDLESKESLKKAAETAAAGMLQYYTG
YRPGDVPGNLPDPYYWWEAGAMFGALVEYWYYTGDSQWNDITTQALLHQVGPANNYMPPN
QTTTLGNDEQDQAFWGLSAMSAAEVKYPNPPEDGPQWLALAQAVYNSQVPRWDNATCGGG
LRWQVFSFNDGYTYKNTVSNGCFFNLASRLAVYTGNESYAARAETTWDWTEGMGLFNKKY
HFFDGTDVRNNCSSINHIQWTYNAGLYLLGAAHMYHFTNQSDRWRSRLEGIIEGLEVFFG
EDNVMSEAACEPHDTCNIDQRSFKAYLSRWMAHTVQIAPFTYDLLMPKLRASAKAAALQC
NGPNNACGLRWRRGAEYDGSTGVGEQMAALEVFQGQLVDYVENRVTASTGGISKGDPNAG
GDTSDEDAVGIAPGHIGVGDRVGAGVGEVNTFTLFLGVSFGLN

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	39	401	1.2e-104	0.9413407821229051

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	42	390	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.24e-04	74	285	44	232	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89684.1|GH76	2.22e-225	54	460	1	407
QVM12533.1|GH76	6.79e-201	1	445	1	440
QSZ36627.1|GH76	1.38e-191	3	457	1	445
QDS70153.1|GH76	2.12e-189	16	461	8	448
APA11655.1|GH76	1.22e-187	33	457	24	444

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.89e-121	37	420	30	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	3.64e-131	33	460	22	442	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	4.57e-128	33	459	19	436	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	3.25e-126	33	459	22	439	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.35e-124	19	420	7	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	2.17e-119	17	446	4	434	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.021604	0.978355	CS pos: 31-32. Pr: 0.9290

TMHMM  Annotations     

There is no transmembrane helices in ATEG_07158-t26_1-p1.